HOG COG KOG arCOG COG description NRC-1 annotation
nucHOG0005arCOG02866 arCOG02867putative winged helix DBD

HOG Organism Gene ID Name Annotation
nucHOG0005 nrc1 VNG0319 vng319 putative winged helix DBD - Bonneau et al 2004
nucHOG0005 nrc1 VNG0768 vng768 putative winged helix DBD - Bonneau et al 2004
nucHOG0005 nrc1 VNG2014 vng2014 putative winged helix DBD - Bonneau et al 2004
nucHOG0005 hmu HMUK2988 Hmuk_2988 conserved hypothetical protein
nucHOG0005 hmu HMUK2339 Hmuk_2339 conserved hypothetical protein
nucHOG0005 hmu HMUK1295 Hmuk_1295 conserved hypothetical protein
nucHOG0005 hma RRNAC0812 hypothetical protein
nucHOG0005 hma RRNAC1807 hypothetical protein
nucHOG0005 hma RRNAC3175 hypothetical protein
nucHOG0005 hwa HQ1100A hypothetical protein
nucHOG0005 hwa HQ1490A hypothetical protein
nucHOG0005 hwa HQ2350A hypothetical protein
nucHOG0005 hla HLAC2385 Hlac_2385 molybdopterin biosynthesis MoaE protein
nucHOG0005 hla HLAC2353 Hlac_2353 hypothetical protein
nucHOG0005 hla HLAC0691 Hlac_691 hypothetical protein
nucHOG0005 hla HLAC0604 Hlac_604 hypothetical protein
nucHOG0005 hbo HBOR20560 Hbor_20560 hypothetical protein
nucHOG0005 hbo HBOR24180 Hbor_24180 hypothetical protein
nucHOG0005 hbo HBOR04640 Hbor_04640 hypothetical protein
nucHOG0005 hut HUTA2636 Huta_2636 conserved hypothetical protein
nucHOG0005 hut HUTA2909 Huta_2909 conserved hypothetical protein
nucHOG0005 hut HUTA0003 Huta_0003 conserved hypothetical protein
nucHOG0005 hut HUTA1976 Huta_1976 conserved hypothetical protein
nucHOG0005 hvo HVO_0799 HVO_0799 conserved hypothetical protein
nucHOG0005 nph NP0378A hypothetical protein
nucHOG0005 nph NP1130A hypothetical protein
nucHOG0005 nph NP2276A hypothetical protein
nucHOG0005 hhi 2333 HAH_2333 hypothetical protein
nucHOG0005 hhi 1456 HAH_1456 hypothetical protein
nucHOG0005 hhi 439 HAH_0439 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


2385|gene|hla      MQPISIVGPGATDLAGTLADRLDGRVAVVDCGGEDGERGEAPGRAAESEVTDGGVAVRRD
378|hp|nph         ----------------------------------------------------------MS
3|chp|hut          ----------------------------------------------------------MV
768|hp|nrc1        ----------------------------------------------------------MS
10812|hp|hma       ----------------------------------------------------------MA
1456|hp|hhi        ----------------------------------------------------------MA
20560|hp|hbo       ----------------------------------------------------------MS
691|hp|hla         ----------------------------------------------------------MS
2350|hp|hwa        ----------------------------------------------------------MS
319|hp|nrc1        ----------------------------------------------------------MS
11807|hp|hma       ----------------------------------------------------------MS
2333|hp|hhi        ----------------------------------------------------------MS
2909|chp|hut       ----------------------------------------------------------MS
1130|hp|nph        ----------------------------------------------------------MS
604|hp|hla         ----------------------------------------------------------MS
1490|hp|hwa        ----------------------------------------------------------MS
24180|hp|hbo       ----------------------------------------------------------MS
799|hp|hvo         ----------------------------------------------------------MS
2636|chp|hut       ----------------------------------------------------------MT
2353|hp|hla        ----------------------------------------------------------MS
2276|hp|nph        ----------------------------------------------------------MS
2014|hp|nrc1       ----------------------------------------------------------MS
1976|chp|hut       ----------------------------------------------------------MS
1100|hp|hwa        ----------------------------------------------------------MS
4640|hp|hbo        ----------------------------------------------------------MS
13175|hp|hma       ----------------------------------------------------------MS
439|hp|hhi         -------------------------------------------------------MTKMS
                                                                               

2385|gene|hla      DSDDEGAAERAADTAIALDADGSWAGRGRVEGLDDLLDGLAPDHDYLVAVGESRLRVPTV
378|hp|nph         E---------------------------LSEEDERILAHLRER----AKGGDRYFRAKHI
3|chp|hut          E---------------------------LNEEEQRILEYLRTR----VASGDSYFRAKNI
768|hp|nrc1        D---------------------------YTDEERRILDYLRES----VDRGERYFRSKNI
10812|hp|hma       D---------------------------YSEEDRRILEYLRDS----VSRGESYFRAKNI
1456|hp|hhi        D---------------------------YSEEDRRILEYLRDS----VSRGESYFRAKNI
20560|hp|hbo       D---------------------------YTDEEQRIIAYLRES----VGAGERYFRAKNI
691|hp|hla         E---------------------------YTEEEQRILAYLTDS----VTRGERYVRSKTI
2350|hp|hwa        E---------------------------YTEEERQIVAYLRDS----VAAGERYFRAKNI
319|hp|nrc1        ATTAASRT--------------------LTPKQHRILSYLQDH-----ADERTYFKSRLI
11807|hp|hma       ATAQTPNSP-------------------LSDKQRRILEYLRSN-----ADDQTYFKSRLI
2333|hp|hhi        ATAQTPNSP-------------------LSDKQRRILEYLRSN-----ADDQTYFKSRLI
2909|chp|hut       TSAAATQDDGP-----------------LSKKQRRILKYLRAN-----ADEQTYFKSRLI
1130|hp|nph        ATAAAATAD-------------------LTRKQRRILTYLREK-----GQTKTYFKSRLI
604|hp|hla         TVQSDAVAVESAG---------------LSAKQASILRYLREN-----AAEQTYFKSRLI
1490|hp|hwa        ATTETETEAEIETNVDGRTTESRSELPMLSEKQQRIHQYLIQQ-----ADQQTYFKSRLI
24180|hp|hbo       ATASNAAPTTD-----------------LSEKQRNILQYLRTN-----APEQTYFKSRLI
799|hp|hvo         TTASAAAVEGEAPDTK----------PSLSEKQRRILDYLRSN-----AGAKTYFKSRLI
2636|chp|hut       AT--------------------------TDTKRQRLRAYLHDR----TAEGECYLKSKFV
2353|hp|hla        TTQSLAQTTEQSTEQSAES---------PASKADRLAAFLREE----AADGETYFKAKFI
2276|hp|nph        ATTEPS----------------------ADSKETRLRRYLRNR----AEEGEVYIKSKFI
2014|hp|nrc1       APNSPSSEAE------------------SQDKETRLKSYLREK----ADDGELYFKSKFI
1976|chp|hut       AKATPSPEREES----------------TASKEQRLRAFLKRK----ASDGEMYFKSKFI
1100|hp|hwa        TTATPSTNADE-----------------DRSKEERLKNYLVSK----AQDGEMYFKSKFI
4640|hp|hbo        ATANPSTEPTAN----------------ELSKEDRLKQYLQEK----AQDGEMYFKSKFI
13175|hp|hma       ATATPSGEE-------------------EPSKEERLKSFLAEK----ASDGEMYFKSKFI
439|hp|hhi         ATATPSGEE-------------------EPSKEERLKSFLAEK----ASDGEMYFKSKFI
                                                      :   *              ..   :

2385|gene|hla      LLGADAEPADVPGSVVA-AADAPDQIDLDGLVTDLADAEPWVTREALVRQVEASADADRA
378|hp|nph         ADAIDLTAKQVGARLPR-LAEQSEDVDIEK----------WSRARSTTWRVTPE------
3|chp|hut          AESIGLSAKQVGVRLPH-LAEKADEVDIEK----------WGRARSTTWRVTRS------
768|hp|nrc1        ADHLGLSSKQVGVRLPE-LAEKSEEVDIEK----------WSRSKSTTWRVEPA------
10812|hp|hma       AEQLGLSSKQVGARLPR-LAEEADEVEIEK----------WGRARSTTWRVTPTG-----
1456|hp|hhi        AEQLGLSSKQVGARLPR-LAEEADEVEIEK----------WGRARSTTWRVTPTG-----
20560|hp|hbo       AEAIGLSAKQVGARLPR-LAEKSEEVEIEK----------WGRARSTTWRVTVG------
691|hp|hla         ADAIGLTAKQVGSRLPR-LAEKSDDVDIEK----------WGRARSTTWRVTPQG-----
2350|hp|hwa        ADAIGLSAKQVGARLPQ-LAEKSDDVDIEK----------WGRARSTTWRVTRG------
319|hp|nrc1        GDELDLSAKEVGANMPA-IEDADHDLDVER----------WGYSSSTTWKVASA------
11807|hp|hma       GDELGLSAKEVGTNMTA-IADGDHDLAVEK----------WGYSSSTTWMVEA-------
2333|hp|hhi        GDELGLSAKEVGTNMTA-IADGDHDLAVEK----------WGYSSSTTWMVEA-------
2909|chp|hut       GEELGLSAKEVGTNMAA-LQEGEYDLTVEK----------WGYSSSTTWMVDA-------
1130|hp|nph        GDALDMSAKEVGANMTA-IQESDVDVSVEK----------WGYSSGTTWKVDVYGGS---
604|hp|hla         ADELDLSAKEVGANMSA-VADAAADIDVEK----------WGYSSGTTWMVTA-------
1490|hp|hwa        AAELGLSAKEVGANMSAIINNNTTDVSIEK----------WGYSSGTTWKVTLESANC--
24180|hp|hbo       AQELGLSAKEVGANMRA-IIDGEFDVTIEK----------WGYSSGTTWKVTV-------
799|hp|hvo         ADDLDLSAKEVGANMRP-ILDGDFDVTVEK----------WGYSSGTTWKVTV-------
2636|chp|hut       ARDLELSTREIGQLFAD-LREEADDLDVER----------WAYSNATTWRVERR------
2353|hp|hla        ADDVGLSPKEIGALIVQ-LQDSVQDLEIEK----------WSYTGATTWRVSTV------
2276|hp|nph        ADDVDLSPKEIGALMVK-LRDSAADIEIEK----------WSYTSATTWRVSRP------
2014|hp|nrc1       ADDVDLSPKEIGALMVK-LSKSATDITVEK----------WSYTSATTWRVQPA------
1976|chp|hut       ADEVNLSPKEIGALMVK-LSESAPDLDVEK----------WSYTSATTWRVEAA------
1100|hp|hwa        ADEVGLSAKEIGALMVK-LRDSATELSVEK----------WSYTSATTWRVETTTEVA--
4640|hp|hbo        ADEVELSPKEIGALMVK-LRDSATELTIEK----------WSYTSATTWRVEPSA-----
13175|hp|hma       ADEVGLSPKEIGALMVK-LKDSASEINVEK----------WSYTSATTWRIEPA------
439|hp|hhi         ADEVGLSPKEIGALMVK-LKDSASEINVEK----------WSYTSATTWRIEPA------
                          . ::   .     .   :: ::           *    . .. :         

2385|gene|hla      GAIATFTGRVRARDAPNDDRTTHLAFEKYEGVAAEQMDAIAAELTERDGVFEVRMHHRTG
378|hp|nph         ------------------------------------------------------------
3|chp|hut          ------------------------------------------------------------
768|hp|nrc1        ------------------------------------------------------------
10812|hp|hma       ------------------------------------------------------------
1456|hp|hhi        ------------------------------------------------------------
20560|hp|hbo       ------------------------------------------------------------
691|hp|hla         ------------------------------------------------------------
2350|hp|hwa        ------------------------------------------------------------
319|hp|nrc1        ------------------------------------------------------------
11807|hp|hma       ------------------------------------------------------------
2333|hp|hhi        ------------------------------------------------------------
2909|chp|hut       ------------------------------------------------------------
1130|hp|nph        ------------------------------------------------------------
604|hp|hla         ------------------------------------------------------------
1490|hp|hwa        ------------------------------------------------------------
24180|hp|hbo       ------------------------------------------------------------
799|hp|hvo         ------------------------------------------------------------
2636|chp|hut       ------------------------------------------------------------
2353|hp|hla        ------------------------------------------------------------
2276|hp|nph        ------------------------------------------------------------
2014|hp|nrc1       ------------------------------------------------------------
1976|chp|hut       ------------------------------------------------------------
1100|hp|hwa        ------------------------------------------------------------
4640|hp|hbo        ------------------------------------------------------------
13175|hp|hma       ------------------------------------------------------------
439|hp|hhi         ------------------------------------------------------------
                                                                               

2385|gene|hla      VIEAGEDIVFIVVLAGHRGEAFRTVEDGIDRLKDEVPIFKKESTEAEEFWVHRRE
378|hp|nph         -------------------------------------------------------
3|chp|hut          -------------------------------------------------------
768|hp|nrc1        -------------------------------------------------------
10812|hp|hma       -------------------------------------------------------
1456|hp|hhi        -------------------------------------------------------
20560|hp|hbo       -------------------------------------------------------
691|hp|hla         -------------------------------------------------------
2350|hp|hwa        -------------------------------------------------------
319|hp|nrc1        -------------------------------------------------------
11807|hp|hma       -------------------------------------------------------
2333|hp|hhi        -------------------------------------------------------
2909|chp|hut       -------------------------------------------------------
1130|hp|nph        -------------------------------------------------------
604|hp|hla         -------------------------------------------------------
1490|hp|hwa        -------------------------------------------------------
24180|hp|hbo       -------------------------------------------------------
799|hp|hvo         -------------------------------------------------------
2636|chp|hut       -------------------------------------------------------
2353|hp|hla        -------------------------------------------------------
2276|hp|nph        -------------------------------------------------------
2014|hp|nrc1       -------------------------------------------------------
1976|chp|hut       -------------------------------------------------------
1100|hp|hwa        -------------------------------------------------------
4640|hp|hbo        -------------------------------------------------------
13175|hp|hma       -------------------------------------------------------
439|hp|hhi         -------------------------------------------------------