HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0497COG1165arCOG046112-succinyl-6-hydroxy-24-cyclohexadiene-1-carboxylate synthase2-succinyl-6-hydroxy-2.4-cyclohexadiene-1-carboxylate synthase

HOG Organism Gene ID Name Annotation
cHOG0497 nrc1 VNG1081 menD 2-succinyl-6-hydroxy-2.4-cyclohexadiene-1-carboxylate synthase
cHOG0497 hmu HMUK2535 Hmuk_2535 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1- carboxylic acid synthase/2-oxoglutarate decarboxylase( EC:2.2.1.9 )
cHOG0497 hma RRNAC0838 menD 2-succinyl-6-hydroxy-2 4-cyclohexadiene-1-carboxylate synthase
cHOG0497 hwa HQ1873A menD 2-oxoglutarate decarboxylase; 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
cHOG0497 hla HLAC1290 Hlac_1290 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate decarboxylase
cHOG0497 hbo HBOR17640 Hbor_17640 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1- carboxylate synthase( EC:2.2.1.9 )
cHOG0497 hut HUTA0815 Huta_0815 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1- carboxylic acid synthase/2-oxoglutarate decarboxylase
cHOG0497 hvo HVO_1469 HVO_1469 menD 2-succinyl-6-hydroxy-2 4-cyclohexadiene-1-carboxylic ac
cHOG0497 nph NP2726A menD 2-oxoglutarate decarboxylase; 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
cHOG0497 hhi 1477 menD 2-succinyl-6-hydroxy-2 4-cyclohexadiene-1-carboxylate synthase
cHOG0497 hhi 4139 HAH_4139 hypothetical protein
cHOG0497 hhi 4111 HAH_4111 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


4139|hp|hhi         ----------------MS------------------------------------------
4111|hp|hhi         ----------------MS------------------------------------------
815|gene|hut        ----------------MTAPNRNTLWATVLVEELAAAGVEYACLAPGSRSTPLTSAFAAH
2726|gene|nph       ----------------MATPNVNTLWGQTVADELATVGIETAVLAPGSRSTPLAVAFAQH
10838|gene|hma      MGRGPAQIPADTRRARMTAPNVNTLWAETLVGELVAGGVDAVCLSPGSRSTPLTVAFAEH
1477|gene|hhi       ----------------MTAPNVNTLWAETLVSELAAGGVDAVCLSPGSRSTPLTVAFAEH
1081|gene|nrc1      ----------------MTAPNRNTLWARAIADELAAAGVHAVCVCPGSRSTPLTVAVDAH
1290|gene|hla       ----------------MTAPNRNTLWARALIDELVAAGVDAVVASPGSRSTPLTVAAART
1873|gene|hwa       ----------------MSAPNQNTLWARTFVSELAASGVDTVCISPGSRSTPLTVAFDRH
17640|gene|hbo      ----------------MTAPNRNVLWARTLVDELAKAGVDAVCITPGSRSTPLTEAFDRH
                                    *:                                          

4139|hp|hhi         ------------------------------------------------------------
4111|hp|hhi         ------------------------------------------------------------
815|gene|hut        EDVDAVSLLDERSAAFFALGRGRQTGKPTAVVTTSGTATANLHPAVMEADEGRVPLVVLT
2726|gene|nph       DDIEAVSLLDERSAAFFALGYAKRTGQPAPLVCTSGTALANFHPAVIEADTARVPMVLLT
10838|gene|hma      PDIEVFSHLDERSAAFFALGRARRTGEPTPLVCTSGTAAANYHPAVIEANQSGVPLLLLT
1477|gene|hhi       PDIEVFSHLDERSAAFFALGRARRTGEPTPLVCTSGTAAANYHPAVIEANQSGVPLLLLT
1081|gene|nrc1      DDLTVYSHLDERSAAFFALGRGKRTGAPTAVLTTSGTATANLHPAVMEAAQARIPLVVLT
1290|gene|hla       DDLRVFSQLDERSAAYFALGRARRTGKVTPLICTSGTAAANYHPAVMEASEARVPLLALT
1873|gene|hwa       DSIETFSHLDERSAAYFALGRARRTGSVTPVVCTSGTAAANYHPAVIEASQARVPLLVLT
17640|gene|hbo      DDIHVFSHLDERSSAFFALGRARRTGDVTPLVCTSGTAAANYHPAIIEAAQSRVPMLVLT
                                                                                

4139|hp|hhi         --------KNKTDKTAAQQ-----------------------------------------
4111|hp|hhi         --------KNKTDKTAAQQ-----------------------------------------
815|gene|hut        ADRPPELQDSGANQTADQTKLYGSAVRRYRTLPEPAPRPRALRSLRVTAARAVADATGTP
2726|gene|nph       ADRPPELADSGANQTIDQADLYGDAVRSYRTLPEPEAAARKLRSLRTTLCRAVGTATGTE
10838|gene|hma      ADRPPELIDSGANQTVDQEKLYGDAVRWYRDMPEPEAEPRKVRMLRTTAARALAESTGSD
1477|gene|hhi       ADRPPELIDSGANQTVDQEKLYGDAVRWYRDMPEPEAEPRKIRMLRTTAARALAESTGAD
1081|gene|nrc1      ADRPPELRGSGANQTVDQEQLYGSAVRYYEDLPEPEVTARKLRSLRTSVCRAVGHTTGPK
1290|gene|hla       ADRPPELRDSGANQTADQEKLYGDAVRFYKDLPEPAPNDRALRSLRTTVARAVGTAEGAD
1873|gene|hwa       ADRPPELHDSGANQTVDQTKLYGDAVRWFHDIGEPEPTARKLRSLRTTAARSIMTATDTP
17640|gene|hbo      ADRPPEIRDSGANQTIDQEKLYGDAVRWYKDLAEPEATPRKLRSLRTTAARALTKATGTP
                             . :::*  *                                          

4139|hp|hhi         ------------------------------------------------------------
4111|hp|hhi         ------------------------------------------------------------
815|gene|hut        PGPVHLNVPFRKPLEPV----HVEGD----VPDDLAERAPLAVDGRDG--PFVEVSQGTP
2726|gene|nph       PGPVHLNVPFRKPLEPLAAAEPPAGVPDGAVPDGFATENPLAARGRDG--PFVEVHSGCT
10838|gene|hma      PGPVHLNCRFRKPLEPT----PMPEDDPAGVPADWAGGDNGAKIGRDG--PFVTTSEGVE
1477|gene|hhi       PGPVHLNCRFRKPLEPT----PMPDDDPAGVPAGWAGGDDAAEVGRDG--PFVTTSQGVA
1081|gene|nrc1      PGPVHLNVPFRKPLEPV----SVPGD----VPPSFDDDHPLAAAGRGGDTPFVSVHDGTT
1290|gene|hla       PGPVHLNVPFKKPLEPT----RVLDD----VPADL---DPVAERGRDG--PYVDVTPGSP
1873|gene|hwa       AGPVHLNFPFRKPLEPT----PVPGD----IPDDL---SEESITGRDG--AFVESTTGNR
17640|gene|hbo      AGPVHLNVPFRKPLEPV----TVEGD----VPDDL---PEIAAEGRED--AFVGTTTGVP
                                                                                

4139|hp|hhi         ------------------------------------------------------------
4111|hp|hhi         ------------------------------------------------------------
815|gene|hut        ALADNDLDDVVDAIEGSDRGLIVAGPAS-QPTPARDALAALARATDFPVLADPLSGHRFG
2726|gene|nph       DPSATTVDELATAVEAAASGLIVCGPTD-RPAPDAESLVALADATGFSVFADPLSGLRFG
10838|gene|hma      TPDEQTVRRVQDALEAAERGLIVAGPAD--QGLSADSLERLAAATGFPVLADPLSDLRFG
1477|gene|hhi       APDERTVRRVQDTLRSAERGLIVAGPAD--QGLSAESLERLATATGFPVLADPLSDLRFG
1081|gene|nrc1      EPAGETAAALAAAATTAARPLVVAGPADGGAGITPDAAAALADATGAPIFADPLSGLRFG
1290|gene|hla       EPGDDALRRLGNELMTTDRGLIVAGPAD-PPGLDAEAVTALSHATGFPILADPLSGVRFG
1873|gene|hwa       VLDENSVNRIAQSL-STSRGLIVVGPMT-IPGVDPEAVAAFAHASGFPVLADPLSGIRYG
17640|gene|hbo      ELDDDALRDLAERL-STPRGLVVAGPAD-APGIDSEAVAAFAHATGFPILADPLSGVRFG
                                                                                

4139|hp|hhi         -------------YDNY------------------PDPDAIVHFG---------------
4111|hp|hhi         -------------YDNY------------------PDPDAIVHFG---------------
815|gene|hut        -HGE--DVPICGGYDSYL---------DACGEWGWPEPDTVVRFGASPTSKILRHYLRDS
2726|gene|nph       PHVD--DAPVCGGYDAYL---------PALE----QTPEVVIRFGASPTSKPLRQYLRDA
10838|gene|hma      PHVDRLDVPVCGGYDGYL---------GSDSVDQWDDPDVVVRFGASPTSKPLRHYLRDA
1477|gene|hhi       PHVDRLDVPVCGGYDGYL---------GSDGVDEWSDPDAVVRFGASPTSKPLRHYLRDA
1081|gene|nrc1      PHVG--DAPVVGGYDGFL---------AADV----PHPEFVLRFGASPTSKPLRKWLAAS
1290|gene|hla       GHTR--VAPVIGAYDAYLSAEVAGEAGDADASDSWNDPEVVLRLGASPTSKRLRKYLAET
1873|gene|hwa       GLTR--TTPIIGGYDGYL---------TSELWDQWPDPDVVLRFGASPTSKPLRQYLEST
17640|gene|hbo      GHVR--VAPVIGGYDSFL---------DEQVTQSWPDPDIVFRFGASPTSKPLRKYLARV
                                 ** :                    *: :..:*               

4139|hp|hhi         ------------------------------------------------------------
4111|hp|hhi         ------------------------------------------------------------
815|gene|hut        EARQFVVDSAGEWPEAEFTASDLLVADPTRLAGRLSDRIA-TGGNSGWRERFERAESEY-
2726|gene|nph       DARQFIVDPAGGWREATFTATDLVVADETRLATAVADAVDRTPGS------YADRLAELE
10838|gene|hma      DCQQFLVDPAGGWSEAEFTATNLLVANPDATADALAGETL-GGVAASWREQFIRAEQTH-
1477|gene|hhi       DCQQFLVDPAGGWSEAEFTATDLLVADPDATADALAAGSL-GSVAASWREQFARAEQTH-
1081|gene|nrc1      DARQVVVDPAGGWREAEFTATDVVAADPAATARAIAARADGT------RSAWTDAVLDLE
1290|gene|hla       GADQYQVDPAGRWREAEFAATDLVVAEPSRLCARLSRLVAGGDGDADWRAQWEDADRVAQ
1873|gene|hwa       SPTQYLVDPAGEWREATFTATDIVVADPTQLLWQLSRALN-TPGSSTWRQRWIEADKAHT
17640|gene|hbo      DAEQLVVDPAAGWREAEFTATDLVVADPSRLMVRLSRLLA-GPGGPEWRKRWENADATHE
                                                                                

4139|hp|hhi         ------------------------------------------------------------
4111|hp|hhi         ------------------------------------------------------------
815|gene|hut        ---WSLLD---------------------------RRTADGSFEGAVLSTVAATVPDTTT
2726|gene|nph       PGYWRLVE---------------------------GEEPQ---EGAMLADAVALAPDPST
10838|gene|hma      ---WDAVT---------------------------ETASETYWEGGVLSDVTALAPDPAT
1477|gene|hhi       ---WDAVS---------------------------ETAAETYWEGGVLSDVAALAPDPAT
1081|gene|nrc1      ARYWAAVD---------------------------DFQPAATLEGEIAATVAAGAPDPAT
1290|gene|hla       EIHGRERD----------------------GDIPADDEPVEFHEGDALRVVADALPDPAT
1873|gene|hwa       DVLANTDSSAHQSLAATNSDSSTDDIIENTDEEGSNESDRWFCEGRILSDVMTAAPDPAT
17640|gene|hbo      SV---------------------------------LETSDEFCEGRVLADVVELAPDPAT
                                                                                

4139|hp|hhi         ------------------------------------------------DVSEELVELVEE
4111|hp|hhi         ------------------------------------------------DVSEELVELIEE
815|gene|hut        LVVGNSMPVRDLDRFGQPRPAAVRVLGNRGVSGIDGVTSTALGAGS--AAEGPLVAVLGD
2726|gene|nph       VFVSNSMPVRDLDRFGAPQAASLSVLGNRGASGIDGIASTALGAGF--GTDDPLVAVTGD
10838|gene|hma      LFISNSMPIRDMDRFGGPRDADLTVLGNRGASGIDGITSTALGAGS--ATSDPLVLVTGD
1477|gene|hhi       LFVSNSMPIRDMDRFGRPRDADLTVLGNRGASGIDGITSTALGAGS--ATADPLVLVTGD
1081|gene|nrc1      VFVSNSMPIRDFDRFAAPRGADLAVLGNRGASGIDGVVSSALGAGS--ATADPVVGLVGD
1290|gene|hla       LFVSNSMPVRDLDRFVGPTTTSVTALGNRGVSGIDGIVSSALGAGS--ATTDDLTLVVGD
1873|gene|hwa       IFVSNSMPVRDLDRFGSPTTQNRTVLGNRGASGIDGIISTALGAGSALATTEHLIAITGD
17640|gene|hbo      IFVSNSMPVRDADRFCPPGTKNLTVLGNRGASGIDGIVSTALGAGS--ATTDDLTLVTGD
                                                                     .   :  :  :

4139|hp|hhi         TL---ETSEFLSTSRDDLPETTLLV-----------------------------------
4111|hp|hhi         TL---ETSEFLSASRDDLPETTLFV-----------------------------------
815|gene|hut        LSFYHDMNGLLALARADVAATIVLLNNDGGGIFHMLPIEDFNPPFSEFFKTPHGLDFSPV
2726|gene|nph       LAYYHDMNGLLAVSRAGVDATIVCINNDGGGIFHVLPIEAH-ESFDKWFRTPHGLDFEPS
10838|gene|hma      LAYYHDMNGLLALGRCAVDATVVLLNNDGGGIFHMLPIEDH-PTFEDQFRTPHGLDFEPT
1477|gene|hhi       LAYYHDMNGLLALGRCAVDATVVLLNNDGGGIFHMLPIDDH-PTFEDQFRTPHGLDFEPT
1081|gene|nrc1      LAYFHDSNGLLALERCGVDATIVLVNNDGGSIFHMLPIEQFDPPFTGQFKTPHGLDFAPT
1290|gene|hla       LALYHDTNGLLALDRCDVDATVVLINNDGGGIFHELPIESFEPEFTESFKTPHGIEFEPM
1873|gene|hwa       LAYYHDMNGLAALERCDVTATIVLINNDGGGIFHKLPIESYDPPFTTQFVTPHGLDFEPT
17640|gene|hbo      LAYYHDMNGLLAIGRSDVDATIVVVNNDGGGIFHMLPIEQFDPPFTSQFKTPHGLDLEPS
                         : . : :  *  :  * : :                                   

4139|hp|hhi         ---------------------------------EAVENE---------------------
4111|hp|hhi         ---------------------------------EAVDNE---------------------
815|gene|hut        EDLYDAEFVRAD-----------SLAAFDSLFGESLSAPGTQIIEVTLDAEESHRIRDAI
2726|gene|nph       AALYDIEFARTD-----------SREGFRSLYSEAVGSGETQVIEVQTESGHNHADRTAL
10838|gene|hma      EALYSLQFERVA-----------DRRQFRERFAESVQTDGTQVIEVRFDAGDSHAVRDQL
1477|gene|hhi       EALYSLEFERVA-----------DRRQFRERFGESVRADGTQVIEVQFDAGDSHAVRARL
1081|gene|nrc1      ADTYALSFARTD-----------TVGEFRAAYRAALGDAGTHVIEVSTDAEASHRERERL
1290|gene|hla       ADLHGLAYTRIDARPDSVESAGNVADDLADAYTGARDADGSHLIEVRTDAESSHRTRKRL
1873|gene|hwa       EDIYDLSFARVR---------GTDRDGFHTAFTEATTTTGSHVIEVVTDSESSHRVREQL
17640|gene|hbo      ADLYGLSFARVE---------GGDSDGFRKAYETATQSEGTHVIEVVTDAETSHTARESL
                                                      :                         

4139|hp|hhi         --------------
4111|hp|hhi         --------------
815|gene|hut        HEDVRAELQ-----
2726|gene|nph       REAVVEELGR----
10838|gene|hma      TEQVAETLAGD---
1477|gene|hhi       AERVAETLAGD---
1081|gene|nrc1      ADRVTGLSV-----
1290|gene|hla       EAAVDRAVHGDEAE
1873|gene|hwa       HDRVIKRILDN---
17640|gene|hbo      RRRVVDELTD----