HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0496COG1007arCOG01540NADH:ubiquinone oxidoreductase subunit 2 (chain N)NADH dehydrogenase/oxidoreductase

HOG Organism Gene ID Name Annotation
cHOG0496 nrc1 VNG0648 ndhG3 NADH dehydrogenase/oxidoreductase
cHOG0496 hmu HMUK1927 Hmuk_1927 proton-translocating NADH-quinone oxidoreductase, chain N( EC:1.6.5.3 )
cHOG0496 hma RRNAC1458 ndhG3 NADH dehydrogenase/oxidoreductase
cHOG0496 hwa HQ1648A nuoN NADH dehydrogenase, subunit N (ubiquinone)
cHOG0496 hla HLAC0714 Hlac_714 proton-translocating NADH-quinone oxidoreductase, chain N
cHOG0496 hbo HBOR21370 Hbor_21370 proton-translocating NADH-quinone oxidoreductase, chain N( EC:1.6.5.3 )
cHOG0496 hut HUTA0692 Huta_0692 proton-translocating NADH-quinone oxidoreductase, chain N
cHOG0496 hvo HVO_0988 HVO_0988 ndhG nadh-quinone oxidoreductase chain n
cHOG0496 nph NP2314A nuoN NADH dehydrogenase-like complex, subunit N
cHOG0496 hhi 2038 nuoN NADH dehydrogenase subunit N (ubiquinone)
cHOG0496 hhi 4065 HAH_4065 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


4065|hp|hhi         ------------------------MKQAAVTHAVVPAALLLQID-------------FPG
714|gene|hla        ----------------MVNTLPQMAALLPVFLLAFTGLALLLVDTI--SPDARSNTSMAV
2314|gene|nph       -------------------MVSDWLLLAPPAAFITAALALFVVDAI--SSDETSGWLLSG
648|gene|nrc1       ------------------------------------------------------------
1648|gene|hwa       MPASTFSMIDIIILQSQSGLPSGILVLTPVILLAATGLILLLIDTI--FTEVSSDSLLAG
21370|gene|hbo      ----------MFEPIALQAAPPEWTAVAPAIILGLTGLLLLVIDSI--NTGEENSALLAS
11458|gene|hma      -----------------MVALPDWMALAPALSLALASLVLLLADSI--DPDSTNTGLLAG
2038|gene|hhi       -----------------MVALPDWMALAPALSLGLASLVLLLADSI--DPDTTNTGLLAG
692|gene|hut        ---------------MAAIELPQWAALAPALVLGLTALALFVIDSIEPEPDTTNTGLLTG
                                                                                

4065|hp|hhi         IPDLYQLFKNGIE-WFLTN------------------VVSGLLDALSAIF--------SL
714|gene|hla        VGALGSLAALAASVWLVVSGTGSADTGGAITLFAEAIKVDTMALFFTAIFASVTALVVVA
2314|gene|nph       VTTAGGLAAAAIAGVLLLSET----AAGGVELFGGQLVVDGMSLLFTFIFGSVTALVAVA
648|gene|nrc1       ----------------------------------------------------------MA
1648|gene|hwa       VSAIGSLLAFGITGWFLISGLGQPQTGGAITLYGDALVVDGLSLFFILIFTIVTTMVAVA
21370|gene|hbo      ISTVGALFAFAVAGWFLVEGTGQSQTGGAITLYGDALVVDGMSLFFTLIFTIVAAMVCIA
11458|gene|hma      ISVLGSLLSFGFAGWFITAGTGMADNTG-VALFNSQLVVDQMALFFMAIVGSVTTLVVLA
2038|gene|hhi       ISVLGSLLSFGFAGWFITAGTGIADSTG-VALFNNQLVVDQMALFFMAIVGSVTTLVVLA
692|gene|hut        VGLAGALAALAFNVWFLVAGTGNPAA---IELFGDQLLVDGMTLFFGTIVASVLALVVLG
                                                                                

4065|hp|hhi         GYEMFLFYPNPADVSVLNTLWEISFSAYVAMAGLSFLYILL----MAQYFAGTDSADLQL
714|gene|hla        AHDYFHDHTNPAAFYSLVVFAATGMALLAAANSLAVVFVALEMVSLPSYVLVAYLKRDRG
2314|gene|nph       SLDYIRDLPHKAEYYLLISLAATGMSLMASANSLVVVFISLELASLPSYALVAYLKNNRG
648|gene|nrc1       SHDYLDDADSVAEFYALTLLAATGMTLMAAANSLVTVFISLELASLPSYVLVSYLKRDRG
1648|gene|hwa       SYDYISAQQYKAEFYSLILFAATGMALMSMSNSLATAFVSLELASLPSYALVSFLKDDQS
21370|gene|hbo      SLDYVAEQRYQAEFYSLVLFATTGMTLMSMSNSLATAFVSLELASLPSYALVGFLKDNKG
11458|gene|hma      SYDYITEHSYQAEFFALVLLSATGMSLLSAANSLATAFVALELVSLPSYALVAFLKENKG
2038|gene|hhi       SYDYVAEHSYQAEFFALVLLSATGMSLLSAANSLATAFVALELVSLPSYALVAFLKENKG
692|gene|hut        SYDYYTGVPYRAEYFSLLFLAATGMTLLGAVNSFATALLALELASLPSYALVASLKDNKG
                    . :        *    *  :   .::      .:    : *    :..*         . 

4065|hp|hhi         HLEKVTKYFAVIFISRELIAFFVAFTHTLTGLYYQTSYDLSIGVTIT-------------
714|gene|hla        SVEAGMKYFLIGALSSAIFLFGISLVYAATGSLLLGDVAEGIGSLDG-------------
2314|gene|nph       SVEAGLKYFLIGALSSGIMLYGISLIYATTGSFLLGDIAASVGEAAST------------
648|gene|nrc1       SIEAGLKYFLIGALSSGVMLYGISLVYAATGVMGLPAIADTITAGTD-------------
1648|gene|hwa       SIEAGLKYLLIGALSSAVFVFGISLVYAATGSLLLSDIAKSV-AETE-------------
21370|gene|hbo      SVEAALKYFLIGAVSSAVFAFGISLVYAVTGSLLLADVASALGGSTE-------------
11458|gene|hma      SVEAGLKYFLIGAVSSAVLAYGISLVYAATGVLRFDGVATAISSGTIQTISEGSIQAQSG
2038|gene|hhi       SVEAGLKYFLIGAVSSAVLAYGISLVYAATGVLRFDGVATAISSGTVQTIVDGSVQAQSG
692|gene|hut        SVEGGLKYFLVGALSSAILVYGISLVYAATGHLAFTEVAGALGDA---------------
                     :*   **: :  :*  :: : ::: :: **          :                  

4065|hp|hhi         ----RAIIDEVGLY----------------------------------------------
714|gene|hla        ----LAGVAGLGIVMILGGVAFKTASVPFHFWAPEAYEGAPAPVSAFLSSASKAAGFVVA
2314|gene|nph       ----HPGVFGVGLLMVIGGFAFKTASVPFHFWAPDAYEGAPAPVAAFLSSASKAAGFVIA
648|gene|nrc1       ----FVGVLGLGIVMLVAGFAFKTASVPFHFWAPEAYEGAPAPVSAFISSASKAAGFAVL
1648|gene|hwa       ----LIGVLGIGILMIAGGFAFKTASVPFHFWAPEAYEGAPAPISAFLSSASKAAGFAVA
21370|gene|hbo      ----MVGVLGIGVLMILGGFAFKTASVPFHFWAPEAYEGAPAPISAFLSSASKAAGFAIA
11458|gene|hma      DPAVPMAILGVGILMIIGGVAFKTASVPFHFWAPEAYEGAPAPISAFLSSASKAAGFVLA
2038|gene|hhi       EPAVPMAILGVGILMIIGGVAFKTASVPFHFWAPEAYEGAPAPISAFLSSASKAAGFVLA
692|gene|hut        ----PAGILGVGVVMVAGGVAFKTASVPFHFWAPEAYEGAPTPISAFLSSASKAAGFVLA
                           :  :*:                                               

4065|hp|hhi         -----------------VGYNW----GVLAVGLMLIAGLGLILILVLRMLIIYVT-----
714|gene|hla        FRLFTEAFPVGASL--AAGIDWVLAFGVLAAVTMTLGNFAAAVQEEVKRMLAYSSIGHAG
2314|gene|nph       FRVLLVGFPIQEVA---ATVDWVLLFQILAVVTMTVGNFAAATQSNVKRMLAYSSIGHAG
648|gene|nrc1       FRVFTTAFPLDVIA--GTVIDWSLLFAALAVVTMTLGNFAAATQENVKRMLAYSSVGHAG
1648|gene|hwa       FRVFVEAFPLGSLP---VGVDWVLAFQVLAVATMTLGNFAAATQETVKRMLAYSSIGHAG
21370|gene|hbo      FRVFFEAFPLAKLP---TGVDWVLAFQVLAVVTMTLGNFAAATQENVKRMLAYSSIGHAG
11458|gene|hma      FRAFAVAFPIGDLLAAGGAINWVMAFQILAIATMFIGNFAAATQETVKRMLAYSSVGHAG
2038|gene|hhi       FRVFAVAFPIGDLLAAGGAINWVMAFQILAIATMFIGNFAAATQETVKRMLAYSSVGHAG
692|gene|hut        FRLFTTAFPYDLIS---GTIDWLLLFQILAVATMVLGNFAAATQRSVKRMLAYSSIGHAG
                                        :*      **   * :..:.      :. :: * :     

4065|hp|hhi         YALLPL----------------------LLAFKLVNVGPWKRVNVMG--------EKFIK
714|gene|hla        YALIGVAALS--QGGSANGAVMGAAMAHLLVYGFMNTGAFLFVAMAERWGVGRTFEDYAG
2314|gene|nph       YVLIGLAALTNVGGPTAEATVLGASMLHLLVYGFMNTGAFLFVAMVEHWDVGRTFEDYNG
648|gene|nrc1       YVLIGLAALQS-GGGAQNSLVLGASMMHLLVYGFMNTGAFLFVALAEYWDVGRTFEDYNG
1648|gene|hwa       YALIGLAALSA-GGPNGD--VLGASMAHLFVYGFMNTGAFLFIALVEHWGVGRTFEDYNG
21370|gene|hbo      YALIGLAAITA-NGPNAN--VLGASMAHLMVYGFMNTGAFLFIALAEHWGVGRTFEDYNG
11458|gene|hma      YVLIGLAAVS--GSGEGLSLSLSAGMSHLLVYGFMNTGAFLFIALAEYWGVGRRFEDYNG
2038|gene|hhi       YVLIGLAAVS--GSGEGLSLSMSAGMSHLLVYGFMNTGAFLFIALAEYWGVGRRFEDYNG
692|gene|hut        YVLISLAALTPQADG---SLVLGAGMLHLLVYGFMNTGAFMFVALAEYWDVGRTFEDYNG
                    *.*: :                      *:.: ::*.*.:  : :          *.:  

4065|hp|hhi         VSAKLMLFGVLVTALIWS-------STLLTDFSTYDSASSGTF---AGGAAVDDSL----
714|gene|hla        LARRAPVASTAMAVFMFSLAGLPPFAGFFSKYFLFMGAIDNGFLWLAAFGAVNSVVSLYY
2314|gene|nph       LAREAPLACVAMTIFLFSLAGLPVGGGFLSKYYLVVGAVGTGVWWLAVVLAINSALSLYY
648|gene|nrc1       LSKRAPVACVAMTVFMFSLAGLPVGAGFLSKYVLFAGAVQSGFAWLAGIAAINSALSLFY
1648|gene|hwa       LVTRAPIAVVAMTVFLFSLAGLPPFGGFVSKYALFYSAIESGFWWLAAVGAVNSALSLFY
21370|gene|hbo      LGSKAPMACVAMSVFMFSLAGLPPFGGFFSKYVLFMSAIESGFWWLAAVGAVNSALSLFY
11458|gene|hma      LGKEAPVACAAMTVFLFSLAGLPIGGGFFSKFYLFSATLNVGAWSLAAALIINSALSLFY
2038|gene|hhi       LGKEAPVACAAMTVFLFSLAGLPIGGGFFSKFYLFQATLNVSAWSLAAALIINSALSLFY
692|gene|hut        LAREAPVAAVAMTIFLFSLAGLPVGAGFLSKYVLFGAAVNAGVWWLAAVGAIASALSLFY
                    :     :  . :: :::*       . :.:.:    .:        *    : . :    

4065|hp|hhi         ------------P--DGRFS-THGQLAQ-YIQDFFLLITPLLMIDFVGFKLIMD------
714|gene|hla        YSRVVKALFIDDPASSSSLDVIDVRPTGLYAAVIFAAVATVLLL--PGFGPVIETAEAAA
2314|gene|nph       YSRVVKAMWIESP--AESLT-IERYPTALYAAVMAAAAVTVLLL--PGLFVFDGAAFDAA
648|gene|nrc1       YSRVVKALWIEDP--RDDLS-LSGQPTGLYVAVLAAAVGTIALL--VAFDPVAQTATHAA
1648|gene|hwa       YSRVIRAMWIESP--TQDLSALDSRPIGLYAAVLFAGVGTLILL--PAFGPVVETAQTVA
21370|gene|hbo      YSRVVKAIWIEDA--SPSLE-IGSKPVGLYTAVIFAAVGTLLLL--PGFRPVIETAQTVA
11458|gene|hma      YSRVVKAMWIEEP--TGSRT-IESYPMGLYTAVVGAAIVTVLLV--PGFNRVSEIAFQAA
2038|gene|hhi       YSRVVKAMWIEEP--TGSRT-IESYPMGLYTAVVGAAIVTVLLL--PGFNRVSEIAFQAA
692|gene|hut        YSRVVKALWFEEP--TQAFE-IDSYPIGLYTAIIVAAVVTVLLL--PAFGFPSEEAIAAA
                                .                *   .     .: ::   .:           

4065|hp|hhi         --LL--
714|gene|hla        SALF--
2314|gene|nph       AALL--
648|gene|nrc1       DVLFAG
1648|gene|hwa       AALF--
21370|gene|hbo      TALF--
11458|gene|hma      QLL---
2038|gene|hhi       QLL---
692|gene|hut        GALV--
                      *