HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0494COG0644KOG2415arCOG00570Dehydrogenases (flavoproteins)geranylgeranyl hydrogenase

HOG Organism Gene ID Name Annotation
cHOG0494 nrc1 VNG2638 bchP geranylgeranyl hydrogenase
cHOG0494 hmu HMUK0269 Hmuk_0269 geranylgeranyl reductase( EC:1.5.5.1 )
cHOG0494 hma RRNAC2126 bchP geranylgeranyl hydrogenase
cHOG0494 hwa HQ3113A electron-transferring-flavoprotein dehydrogenase / geranylgeranyl hydrogenase-like protein
cHOG0494 hla HLAC1298 Hlac_1298 geranylgeranyl reductase
cHOG0494 hbo HBOR27950 Hbor_27950 geranylgeranyl reductase family protein( EC:1.5.5.1 )
cHOG0494 hut HUTA0005 Huta_0005 geranylgeranyl reductase
cHOG0494 hvo HVO_0396 HVO_0396 bchP geranylgeranyl hydrogenase
cHOG0494 nph NP0512A electron-transferring-flavoprotein dehydrogenase 3
cHOG0494 hhi 2611 bchP geranylgeranyl hydrogenase
MUSCLE (3.6) multiple sequence alignment


5|gene|hut          -MHDVIVVGAGPAGSRFARRAASDGHDILVFEQGEIGEPLACSGHVSTDVLEFVPPDDRD
12126|gene|hma      -MYDVVVVGAGPAGSRYARQAASRGLDVVVFEQGEIGKPLACSGHVSTDIWEFT-EDARD
2611|gene|hhi       -MHDVVVVGAGPAGSRYARQAASRGLDVVVFEQGEIGKPLACSGHVSTDIWEFT-EDARD
1298|gene|hla       -MHDFVVVGAGPPGSRFARRAAAAGRDVVVFEKGSIGTPLACSGHVSDDVWEYVPDDARD
3113|gene|hwa       -MYDFAVVGVGPAGARFAREAAATGHDVIAFEKGTIGTPLACSGHVSTDIWEYVPDGAVT
27950|gene|hbo      -MYDFAVVGVGPAGARFARRAAEAGYDVVAFEKGEVGTPLACSGHVSTDIWAYVPDEAKT
512|gene|nph        -MYDFIVVGAGPAGSRFARAAAERDHGVLVLESGAIGEPLACSGHVSLDVWAFVPETARE
2638|gene|nrc1      MMYDFVVVGVGPAGARFARRAAQQGYDVIAFEQGDLGTPLACSGHVSLDVWEFVPDEHHD
                     *:*. ***.**.*:*:** **  . .::.:*.* :* ********* *:  :.      

5|gene|hut          KLRQNEIYGARFHLGGPASRAYPFYKDEVVSRVIDRVELDRTLARAASEAGADVRDGHTV
12126|gene|hma      ELFQNEISGARFHTGGPGSQDHPFYKDEVISNVIDRVGLDKHLAGLARDAGADVREAHSV
2611|gene|hhi       ELFQNEISGARFHTGGPGSQDHPFYKDEVISNVIDRVGLDKHLAGLARDAGADVREAHSV
1298|gene|hla       ELLQNRVYGARFHVGGPGSKAYPFYKSEPVSNVIDRVGLDRTLADCAREAGADVRENHTV
3113|gene|hwa       DLRQNTIYGARFHVGGPQTDPHPFYKREAVSNVIDRVDLDRTLATAARSCGADIREEHTV
27950|gene|hbo      TLFQNRIYGANFHVGGPNSRDYPFYKNEEVSNVIDRVELDRTLAACARDAGADVRERHTV
512|gene|nph        RLHQNDIYGARFHLGGADSRAYPFYKETVVSNAIDRVGLDRTLAECARDAGAEVREQHTV
2638|gene|nrc1      ALFQNDIRGARFHLGGADSSAHPFYKSTPISNAIDRVHLDEVLAEAARDAGADVREHHTV
                     * ** : **.** **. :  :****   :*..**** **  **  * ..**::*: *:*

5|gene|hut          TDVEERDDSVVVTVSGP-DGVETHQSRMVAGCDGPQSRVRDAVSLPEPDELLHGVLGFDD
12126|gene|hma      VGVTEDRDGVTVEVRGD-DGVETHRAKMVAGCDGPKSRVRRELDLPEPDELLHGVLGFSD
2611|gene|hhi       VGVTEDRDGVTVEVRGD-DGVEAHRAKMVAGCDGPKSRVRRELDLPEPDELLHGVLGFSD
1298|gene|hla       VGVDERDDRVVVEVRTPAGDVETVEARMVAGCDGPTSRVRRSLGLPEPDELLHGVLAFDE
3113|gene|hwa       TNIDERHDRVTLTVSHS-GDKETFRARMVAGCDGPVSRVRRQAGLPEPDELLHGVLAFDS
27950|gene|hbo      TNVEERHDGVELTVSAG-GDEQTIEAKMVAGCDGPVSRVRRQAGLDEPEEILHGVLAFDE
512|gene|nph        TAVTEGSDRATVTANGP-DGTEQFAAKVVCGADGPRSKVRSQVGLPEPDELLHGVLGFEP
2638|gene|nrc1      TDVTEHRNRVTVTARGP-DDSIDVTAKMVAGSDGPRSRVRDALSLPEPDEFLHGALAFDP
                    . : *  : . : .    ..     :.:*.*.*** *.**   .* **:*:***.*.*. 

5|gene|hut          DPDDGDFVDVHLTVPRFFAWRIPRGDAGVEYGLAVPPGEAAGDRFEAFTDSYGVETDRRC
12126|gene|hma      EVDHGDFVDVHLTVPRFFAWRIPRGEAGVEYGLAVPPGDDARGRFEEFVDGYGVETDHRC
2611|gene|hhi       EVDHTDFVDVHLTVPRFFAWRIPRGEAGVEYGLAVPPGDDARGRFEEFVDGYGVETDHRC
1298|gene|hla       APDDGDLVDVHLTAPTFFAWRIPRGDAGVEYGLAAPPSDDVSAMFDRLTDAYDVTTDHFC
3113|gene|hwa       TPDTADFVDVHLTAPEFFAWRIPRGEAGVEYGLAAPPNESVSALFDRLTDAYDVETEQFC
27950|gene|hbo      APDDSDFVDVHLTVPRFFAWRIPRGDAGVEYGLAAPPGAEVNEMFDVLTDAYDVETTHFC
512|gene|nph        TPDSQDFVDVHLTVPGFFAWRIPRGEAGAEYGLAVSPGDDAPARFEALVEDYGVDIERRC
2638|gene|nrc1      DPDHQDFVDVHLTVPGFFAWRIPRGDAGVEYGLAAAPGEDVAGRFDDLVADYGVDVEHRC
                      *  *:******.* *********:**.*****..*.  .   *: :.  *.*   . *

5|gene|hut          SGLIPIGPPDSVTSERTFLLGDAAAQTKPFTGGGIRYGMTAADHAAREIDPTDPSTLAAY
12126|gene|hma      SGLIPIGPPKRVTGRRSFLIGDAAAQTKPFTGGGIRYGMTAADHAAREIDPEDPATLGEY
2611|gene|hhi       SGLIPIGPPKRVTGRRSFLVGDAAAQTKPFTGGGIRYGMTAADHAAREIDSEDPATLGEY
1298|gene|hla       SGAIPVGPPERVTTDRAFLIGDAAAQTKPFTGGGILYGMTAADVAAEVIDPRDPATLADY
3113|gene|hwa       SGAIPIGPPSRVHTRRVFLIGDAAAQTKPFTGGGILYGMTAADAAVATIDPDDPATLRDY
27950|gene|hbo      SGGIPIGPPDRVTTRRVFLLGDAAAQTKPFTGGGILYGMTAADCAVDTIDPDDPATLRDY
512|gene|nph        SGAIPIGPPDRTVSERTFLLGDAAGQTKPFTGGGILYGMRAADVAARVLDPDRRSTLYRY
2638|gene|nrc1      SGLIPIGPPDTVTSHRGFLLGDAAGQTKPFTGGGIRYGMTAADAAARELDPDRPGTLAGY
                    ** **:***. .   * **:****.********** *** *** *.  :*.   .**  *

5|gene|hut          ERAWRRDLGREISLGSWVRRGYSFPAPLQRVGLGLLAGEIGVHMDEPSSLFSREQLAALR
12126|gene|hma      ERAWRDDLRQEIRLGHAVRAGYSAPEPIQKAGMKAFEGEIGVHMDRPTTLFSREQLAALF
2611|gene|hhi       ERAWRDDLRQEIRLGHAVRAGYSAPEPIQKAGMKAFEGEIGVHMDRPTTLFSREQLAALF
1298|gene|hla       ESGWRDAIGTEIRLGSAIRRCYSLPEPVQRTGLWALSGEIGVHMDRPSSFFSPAHLKKLF
3113|gene|hwa       DRAWREELANEIELGHWIRRAYSLPPTVQRAGLRALSGEIAVHMDRPTSLFSRDQLRALV
27950|gene|hbo      ESAWRSELSQEIAMGHWIRRAYSLPERVQHFGLRSLSGEIGVHMDKPTSFFSREHLTKLL
512|gene|nph        EHAWRDELARDQRLGRLIRAGYSLPKPVQRAGMAAFAGEIGVHMDRPSTLFSVDQLRAMA
2638|gene|nrc1      ERAWRDALEREITLGHLVRAGYSMPTPIQSAGLRLFSGEIAVDMDKPTSLFSLDQARALL
                    : .**  :  :  :*  :*  ** *  :*  *:  : ***.* ** *:::**  :   : 

5|gene|hut          SR--------
12126|gene|hma      SRS-------
2611|gene|hhi       SRS-------
1298|gene|hla       SRSNRENAPR
3113|gene|hwa       GR--------
27950|gene|hbo      GR--------
512|gene|nph        PWR-------
2638|gene|nrc1      R---------