HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0493COG1233arCOG01523Phytoene dehydrogenase and related proteinsprobable oxidoreductase

HOG Organism Gene ID Name Annotation
cHOG0493 nrc1 VNG0542 oxi probable oxidoreductase
cHOG0493 hmu HMUK2885 Hmuk_2885 amine oxidase
cHOG0493 hma RRNAC3504 flavin-containing amine-oxidoreductase
cHOG0493 hwa HQ1565A crtI phytoene dehydrogenase (phytoene desaturase)
cHOG0493 hla HLAC0732 Hlac_732 amine oxidase
cHOG0493 hbo HBOR24000 Hbor_24000 UDP-galactopyranose mutase
cHOG0493 hut HUTA2794 Huta_2794 amine oxidase
cHOG0493 hvo HVO_0817 HVO_0817 flavin-containing amine-oxidoreductase
cHOG0493 nph NP1630A crtI_3 phytoene dehydrogenase 3 (phytoene desaturase)
cHOG0493 hhi 722 HAH_0722 flavin-containing amine-oxidoreductase
MUSCLE (3.6) multiple sequence alignment


542|chp|nrc1        -------MTPPPQHTAMTDEEAVVVGGGLAGLVAARHLAADGLDVTLFERNPTVGGRVRS
732|gene|hla        -----------------MHGDATVVGGGLAGLVAATRLAEAGADVTLYERRPEVGGRVRT
1565|gene|hwa       ----------------MSTDSVVVVGAGLAGLVAARHVAQTGATVTVYERQSDVGGRVQT
24000|gene|hbo      ----------------MDGETVVVAGAGLAGLVAARHLADAGADVTVFERRPEVGGRVRT
2794|gene|hut       ------------------MTDVIVAGGGLAGLVAARHLAEDGLDVTAFEADSSVGGRVHT
1630|gene|nph       -------------------MHVVVAGGGLAGLVAARHLAEAGAEVELFERNERVGGRVRS
13504|gene|hma      ------------------MTDVVVAGGGLAGLVAARHLAESGRDVTVFEQRSDVGGRVRT
722|gene|hhi        MVRSRFSTLLSRAAELGGMTDVVVAGGGLAGLVAARHLAESGRDVTVFEQRSDVGGRVRT
                                         . *.*.******** .:*  *  *  :*    *****.:

542|chp|nrc1        THADGFTFDRGFQVLFTSYPAAKRELDFDALDLRSFSPGAVICRGDRRAVLGDPLRDPGA
732|gene|hla        ETVNGFTLDRGFQVFFTSYPAVVAELDIDALDIRQFAPGATICRPGSRSVLSDPLRDPRA
1565|gene|hwa       RHQDGFIIDRGFQVLFTSYPAVTRELDLDSLSLRRFTPGAVIARPGSRSVLSDPLRDPRA
24000|gene|hbo      QKRDGFTFDRGFQVLFTKYPAVRRELDLSALDVRYFAPGAVIARPGQRSTLSDPIRDPRA
2794|gene|hut       HKDDGFTYDRGFQVVFDSYPAVKRELDVDALDLRRFAPGATLARPGERSVIADPLRDPRT
1630|gene|nph       RTVDGFTIDRGFQVLFTGYPAAQRELDFDALDLRAFAPGATIAAPNHRSTLADPLGDPGA
13504|gene|hma      VHEDGYTFDRGFQVMFTAYPAAKRELDIEALAPRTFTPGATIASPNHRSVLSDPLRNPSA
722|gene|hhi        AHEDGYTFDRGFQVMFTAYPAAKRELDIEALSPRTFTPGATIASPNHRSVLSDPLRNPSA
                       :*:  ******.*  ***.  ***..:*  * *:***.:.  . *:.:.**: :* :

542|chp|nrc1        LVPSVLNREVSTMDKLRTLLLKRELTRKPFADIW--SDADATIEQYLAARGFSDRYVDRF
732|gene|hla        AIASLLNDEVSLSDKLRTLALRHDLAKRDEGAFF--TGRDASIREYLHDWGFADDYVTNF
1565|gene|hwa       AISSLQNNEVTQTDKIRTLLLRQHVGTRTEKEIF--ESPDQSIRSYLQEWGFSDDYLDHF
24000|gene|hbo      TVASLQNDEVTTTDKLRTLALRQHVGSMTENEIF--GSEDDSIRDYLREWGFSEDYIEHF
2794|gene|hut       VTQTLFNREIPFGDKLRVLKLRQELAGRDEGDIFDPTRPDRTIEAALADRGFSQAFGERF
1630|gene|nph       AVPTLLNRDVRLSDKLRLFRLQRRLKRRAVDAIF--EGDDRTIREYLAAEGFSTAFVERF
13504|gene|hma      APQTLLNTDVRTADKLRLFRLQRELAGVEPVELL--SRGGTTIREYLADYGFSKRFVERF
722|gene|hhi        APQTLLNTDVRTADKLRLFRLQRELANVEPVELL--SRDGRTIREYLADYGFSQRFVERF
                       :: * ::   **:* : *.. :       :      . :*   *   **:  :  .*

542|chp|nrc1        VRPFYGGITLDRSLSTSKRVFEYTFKLLADGRTVLPAAGMGAISAQLAARARDAGVTIEP
732|gene|hla        VEPFYGGITLDRTLSTSKHVFEYTFRAMSRGTIAVPAAGMRAIPEALAARARDAGVTIET
1565|gene|hwa       IAPFYGGITLDRSLSTSKRVFEYTFKSLSTGEIALPANGMQAVPQQLAMHARDAGASIVC
24000|gene|hbo      VAPFYGGITLDRSLSTSKRVFEYTFKMLSEGSIGVPAGGMQAVPEQLAANARKAGARIVT
2794|gene|hut       VAPFYGGITLDRTLSMDARIFEYTFARLIEGSAAVPADGMAAIPKQLARRARDAGARIET
1630|gene|nph       AEPFYGGITLDRELETSSHVFEYTFKMLSEGRTVVPAEGMGAIPAQLRTAAETAGATVRT
13504|gene|hma      AAPFYGGITLDRSLGTDSSIFEYTYKMLSEGEIFVPADGMQAMPRQLADRARSAGATIET
722|gene|hhi        AAPFYGGITLDRSLGTDSSIFEYTYKMLSEGEIFVPADGMQAMPRQLADRARSAGATIET
                      ********** *  .  :****:  :  *   :** ** *:.  *   *  **. :  

542|chp|nrc1        ETPVEAVHSD---------------PAAVDV-PGERIDADAVVVATDPDAARELTGVDAI
732|gene|hla        GEDVESVRTAGQGRIPFRTGSGDATGATVELADGSTRETDAVVVAATPPEARRLTGVESI
1565|gene|hwa       EEGVTDIIDHTD-------------SVTIET-DTTTTDADAVIIATDPADARQLTGVNSI
24000|gene|hbo      ESGVEHIDDNGD-------------SATITT-VEETVDADFVVVATDPKEARRLTDVNQI
2794|gene|hut       GVTVESIDADAGET------GETGDSVRVTV-DGETITAAGAVVATDPGTAGELTGVET-
1630|gene|nph       GTAVTDITTDDG-------------EVTVRT-DDGTQTADAAVVATDPNAAAELTDIET-
13504|gene|hma      DAPVTELETHEG-------------EVTAEV-GRETVTAESAVVATDPQTAAELTDIDAI
722|gene|hhi        DAAVTDLETHEG-------------EVTAEV-GNETVSAESAVVATDPQTAAELTDIDAI
                       *  :                   .           :  .::*: *  *  **.::  

542|chp|nrc1        PTDWKGCTTQHVALPAAHPLGDSDRIHLNAADDVPNTVAPMSGVAPEYAPDDRELVAVTT
732|gene|hla        PTEGVPNVTGWYTLPAGESFETGKRILLNAADDSPNAVVPMSEVAPEYAPDDRALIAATF
1565|gene|hwa       PTDTRGCVTQYYELPVTDAPETRKKIILNAAEPAPNTVVPLSNVASEYAPDNKALLNATF
24000|gene|hbo      PTNARSCVTQSYRLPKGTKLETRKKLLLNAADDAPNTVVPMSEVAPEYAPDDAELVNATF
2794|gene|hut       PTEYRGCATVYASLPSETQLDTGKRLLLNVADDRPNQVAPMSAVAPEYAPDGQQFLAATF
1630|gene|nph       PDAGLGCVTVHCSLPERQALDTGSRILLNADDDEPNTIAPMSAAAPAYAPEGSQLLSATF
13504|gene|hma      PTEPVGCVTQYFALPTNRAPATGQRIILNATDDRPNTVAPLSAVASEYAPAGMELYSATF
722|gene|hhi        PTEPVGCVTQYFALPTNRAPTTGQRIILNAADDRPNTVAPLSAVASEYAPAGMELYSATF
                    *      .*    **        ..: **. :  ** :.*:* .*. *** .  :  .* 

542|chp|nrc1        LGTP--DRSSTALATAARDAIADWYPEASLGAFEVLHTHRVPFSQFAQPPGVHDTLPDTT
732|gene|hla        LGESSLDRPAAGLRDDVRDALEAWYPDRDFDGLETVDVHRIRFAQFAQPPGVHAALPDPD
1565|gene|hwa       LSSAAFEHDIDTLAEQTQSALSSWYSDRDFDSLKPIATDRIEFAQFDQPPGVHDALPQAR
24000|gene|hbo      LGTSALDRDASELAEMTRKTLESWYPDRMFDGLEPIHTDRIEFAQFDQPPGVHDALPTNR
2794|gene|hut       LGVP--AADDETLFEETRDTLSQWYPERSFAALEHRRTERVPFAQIDQPPGFQSGLPDPD
1630|gene|nph       LGTA--DRDDAALGETVREALAAWYPENRFAELDVVAVDRVPFAQFAQPPGFRADLPSPD
13504|gene|hma      LGTP--EEDDAELAAEVRAALQSWYPNASFEALELLRTDRVPLSQFAQPPGYRDALPDPT
722|gene|hhi        LGTP--EAGDEQLAAEVRDALQSWYPNATFEALELLRTDRVPFAQFAQPPGYRESLPDPT
                    *. .        *   .. ::  **.:  :  :.   . *: ::*: **** .  **   

542|chp|nrc1        APAGAVYVAGSYTHNASINGAMESGRAAARAASDHVS--
732|gene|hla        DPEGPVVLAGDYTEWSSIQGAVESGRSAAEAAGEYL---
1565|gene|hwa       APGGRVYLAGDYTTWSGIQGAMRSGREAAVAVNTDRST-
24000|gene|hbo      EPGGRTYLAGDFTAWSSIQGAMQSGRNAAEAVRSDAE--
2794|gene|hut       DPDGPVVLAGDYTRWSSIQSALQSGRIAAETLLDGPGLP
1630|gene|nph       APDGPVVLAGDYTRWSSIQGALESGRQAAEAVLEQR---
13504|gene|hma      APEGNAVLAGDYTRWSAIQGALESGKVAADLLR------
722|gene|hhi        APDGNAVLAGDYTRWSSIQGALESGKVAADLLR------
                     * * . :**.:* .:.*:.*: **. **