HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0490COG0382KOG1381arCOG004784-hydroxybenzoate polyprenyltransferase and related prenyltransferasespossible lycopene elongase

HOG Organism Gene ID Name Annotation
cHOG0490 nrc1 VNG1682 lye possible lycopene elongase
cHOG0490 hmu HMUK1361 Hmuk_1361 UbiA prenyltransferase
cHOG0490 hma RRNAC0320 ubiA prenyltransferase
cHOG0490 hwa HQ2862A ubiA prenyltransferase
cHOG0490 hla HLAC1898 Hlac_1898 UbiA prenyltransferase
cHOG0490 hbo HBOR10660 Hbor_10660 4-hydroxybenzoate polyprenyltransferase-like prenyltransferase
cHOG0490 hut HUTA2374 Huta_2374 UbiA prenyltransferase
cHOG0490 hvo HVO_2527 HVO_2527 prenyltransferase
cHOG0490 nph NP4766A ubiA prenyltransferase
cHOG0490 hhi 1057 ubiA1 prenyltransferase
MUSCLE (3.6) multiple sequence alignment


2374|gene|hut       ---MMTAPSGRAGRSS-----LLDRLRYLLVLSRPRFWLYLAGPVIIGVVYAADSTADLI
4766|gene|nph       ------MSQPLFDRL---LPSDATAAGYLLRLSRPRFWLYLAGPVVVGVAYAAETPAELF
10320|gene|hma      ------MPELPTDRITAVIPPEETLVGYLLRLSRPRFWLYLGGPVIVGVSYAADGPGELF
1057|gene|hhi       ------MPELPTDRITAVIPPEETLVGYLLRLSRPRFWLYLGGPVIVGVSYAADGPGELF
1682|chp|nrc1       ------------------------MFRYLFVLSRPRFWLYLAGPVLVGVSYGATTVGELF
1898|gene|hla       MIGAVSDTVTGPDQRS-----IPDLLQYLLVLSRPRFWLYLAGPVAVGVTYGIADVSELF
10660|gene|hbo      -MSHQRPTDGRKDGRTDGVMNARGRLEYLLTLSRPRFWLYLAGPVAVGVAFAATAVSDLL
2862|gene|hwa       ---MQTDIDTDTPNRD-----VLGRVWYLLTLSRPRFWLYLAGPIVVAVAFGATSVSELF
                                               **: **********.**: :.* :.    .:*:

2374|gene|hut       TPLSVALFAYFLVPANVFLYGVNDVFDADIDTENPKKDEGPEVRFSGERWVLAVVIGSGL
4766|gene|nph       SPLAVALFAYFLLPANVFLYGVNDIFDADIDIENPKKE-QREVRYRGDWTVPALVVATGA
10320|gene|hma      SPLAIALFLYFTIPGNVFLYGVNDIFDADIDEHNPKKDEGREVSYRGDSAITAIVVASGA
1057|gene|hhi       SPLAIALFLYFTIPGNVFLYGVNDIFDADIDEHNPKKDEGREVSYRGDSAVTAIVVASGA
1682|chp|nrc1       SAPAVVLFSYFLLPANIYLYGINDVFDRDVDETNPKKD-GRESRYRGGAAVAVIVAVCGV
1898|gene|hla       TPVTVGLAAYFLVPANVFLYGVNDAFDADIDELNPKKE-GREARWRGDRLVALAVVVSGA
10660|gene|hbo      SPAALVLFGYFLLPGNILLYGVNDAFDADVDEANPKKD-DREARWQGDTVVTAVIVASGV
2862|gene|hwa       LPENIVFFAYFLFPANVFLYGVNDVFDADVDVVNPKKE-GRETRWQGDPVVAASVVITTA
                     .  : :  ** .*.*: ***:** ** *:*  ****:   *  : *   :   :     

2374|gene|hut       LAVPFALVVGPAGKVKLGAFLVLAVEYSAPPFRFKTTPALDSLSNGLYVLPGVLAFTAVA
4766|gene|nph       LGVAFLPALPLAGVAAMVGFLFLAVEYSAPPLRFKTTPWLDSLSNGLYILPGVVAYAGIA
10320|gene|hma      LALLFVLGLPTLGVVALLAWIGLSVEYSAPPLRFKTTPFLDSISNGLYILPGVIGYAAIE
1057|gene|hhi       LALVFVLGLPMLGVVALLAWVALSVEYSAPPLRFKTTPFLDSISNGLYILPGVIGYAAIE
1682|chp|nrc1       FLGFVAAPLPAEAWPYLAAWFVLATEYSAPPLRFKTTPVLDSLSNGLYVLPAAAAYAGVS
1898|gene|hla       LGVAVFAITPRVAWPYLAGFLLLGAGYSAPPVRFKTTPFLDSVSNGLYILPGAAAYAAVS
10660|gene|hbo      LGLGLFAVAPRLTWPYLAGFFLLGVEYSAPPFRFKTTPFLDSVSNGLYILPGAAAFAAVA
2862|gene|hwa       LGIVIFAISPQAAWPYLLGFFILGFQYSAPPLRFKTTPIFDSLSNGLYILPGAAAYATVT
                    :   .           : .:. *.  *****.****** :**:*****:**.. .:: : 

2374|gene|hut       GELPPTPAIVGGWLWTMAMHTFSAIPDIEPDRRAGIATTATVLGQRRTYAYCGIVWALAA
4766|gene|nph       GDGPPLAAIAAGWLWAMGMHTFSAIPDIDPDRAAGIETTATVLGARRTYAYCGGCWLAAA
10320|gene|hma      GVAPPATAVAGAWLWAMGMHTFSAIPDIEPDREAGIQTTATFLGESNTYYYCVMCWLTAA
1057|gene|hhi       GAAPPATAVAGAWLWAMGMHTFSAIPDIEPDREAGIQTTATFLGESNTYYYCVMCWLTAA
1682|chp|nrc1       GTHPPLLAVAGGWLWAMGMHTFSAIPDIEPDRAAGIQTTATALGADRALAYCAGIWLLSA
1898|gene|hla       GTHPPIAALAGAWLWAMGMHTFSAIPDIEPDRAAGIRTTATLLGEGRTYAYCVACWVAAA
10660|gene|hbo      GQHPPLSALVGAWAWTMGMHTFSAIPDIEPDRTAGIRTTATFLGERRTYAYCFACWLVAA
2862|gene|hwa       GNQPPLAAVAGGWFWTMGMHTFSAIPDIEPDRAAGIQTTATFLGEPRVYTYCLCCWLAAA
                    *  **  *:...* *:*.**********:*** *** **** **  ..  **   *  :*

2374|gene|hut       GAFALIYPLLGATLAVYPLLQVGIAVSGVAVDRAYWWFPAINTVVGMALTMGYLWRLMYG
4766|gene|nph       AVFGTVDVFFAAVLGIYPVFVAAIAGLGIDPERAYWWFPALNTAAGTALTLGALWVMLHA
10320|gene|hma      FVFTYTHWVFGLILLVYPGLVFGILGIGVDIDEAYWWYPAINTVVGMVFTLIALWVMLYG
1057|gene|hhi       FVFTYTHWVFGLLLLVYPGLVFGILGIGVDIDEAYWWYPAINTVVGMVFTLIALWVMLYG
1682|chp|nrc1       AVFALVDVRFGLLLLAYPVLVFGIRRLQVAVGRAYWWYPAVNTLVGMVFTLGGLWGVVHG
1898|gene|hla       VAFAAVDIRLGVLLGVYPVFAAWVARSSIAVDRAYWWFPALNTAVGTLLAMGGLWRVYPV
10660|gene|hbo      AAFALVDWRLGAVLSAYPLAVLAVARSEISVERAYWWYPVLNTVIGATLTMGALWRLFYG
2862|gene|hwa       VSFAFLDNRIALLLLAYPVIVFAIYWSDIAVDRAYWWYPAVNTIVGMLLTMGALWRLLYG
                      *      :.  *  **     :    :    ****:*.:**  *  :::  ** :   

2374|gene|hut       G----
4766|gene|nph       -----
10320|gene|hma      -----
1057|gene|hhi       -----
1682|chp|nrc1       -----
1898|gene|hla       TEALA
10660|gene|hbo      -----
2862|gene|hwa       -----