HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0049COG0454KOG4144 KOG2488 KOG3138 KOG3139 KOG3216 KOG3396arCOG00838Histone acetyltransferase HPA2 and related acetyltransferasesHpa2-like histone acetyltransferase

HOG Organism Gene ID Name Annotation
cHOG0049 nrc1 VNG2522 act9 Hpa2-like histone acetyltransferase
cHOG0049 hmu HMUK0222 Hmuk_0222 GCN5-related N-acetyltransferase
cHOG0049 hmu HMUK1304 Hmuk_1304 GCN5-related N-acetyltransferase
cHOG0049 hma RRNAC2222 acetyltransferase
cHOG0049 hma RRNAC3187 hypothetical protein
cHOG0049 hma RRNB0027b aroA 3-phosphoshikimate 1-carboxyvinyltransferase
cHOG0049 hwa HQ1064A protein N-acetyltransferase-like protein
cHOG0049 hla HLAC1911 Hlac_1911 GCN5-related N-acetyltransferase
cHOG0049 hbo HBOR03860 Hbor_03860 acetyltransferase (GNAT) family protein
cHOG0049 hut HUTA0967 Huta_0967 GCN5-related N-acetyltransferase
cHOG0049 hvo HVO_1821 HVO_1821 acetyltransferase (gnat) family
cHOG0049 nph NP1712A protein N-acetyltransferase-like protein
cHOG0049 hhi 2694 HAH_2694 acetyltransferase (GNAT) family protein
cHOG0049 hhi 450 HAH_0450 GCN5-like N-acetyltransferase
MUSCLE (3.6) multiple sequence alignment


10127|gene|hma      MDITIAESTVEGTAQAPPSKSYTHRAVLAAGYADGAVVHDPLVSADTKATMRAVEAYGGS
13187|hp|hma        -------------------MSNAAA-------ADHDFPRPPETFTDHDGRTVTIEAYDG-
450|gene|hhi        -------------------MSNAAA-------ADHDFPRPPETFTDNDGRTVTIEAYDG-
1712|gene|nph       -----------------MTREYPTE-------IAGPYEAPPRETEDRDERRIEVRRYDD-
2522|chp|nrc1       ---------------MPGERVYPED-------AAGSFPTPPLRITDSDGREITVDAFTGD
967|gene|hut        ---------------MNGDRSYPAE-------ISGPFPTPPHRFIDGIGREIVVRVADD-
12222|gene|hma      -----------------MTRTYPDE-------PAEEFPQPPRTITDREDRSIDVIPADD-
2694|gene|hhi       -----------------MTRTYPDE-------PAEEFPQPPRTITDRKDRPIDVIPADD-
1064|gene|hwa       ---------------MSPDHTCPDD-------SAGPFPLPPRTFTDRAGRDIEIRVYDG-
1911|gene|hla       ----------------MSDRGYPEA-------VANEFSTPPTAFTDREGRTIEVRPYEN-
3860|gene|hbo       ---------------MSTERRYPDA-------VAGPFESPPVTFEDREGRDIEVRPYDG-
                                          .                 *    *       :    . 

10127|gene|hma      VSLAEDESTVEVTGFDGRPETPDDVIDCANSGTTMRLVTATAALQDDLAVLTGDESLRSR
13187|hp|hma        ---DIDPLVEMYADFG-----TDSRSQGVPPRT-------EADIRDWLPNLVED----G-
450|gene|hhi        ---AIDPLVEMYVDFG-----PDSRSQGVPPRT-------EADIRDWLPNLVED----G-
1712|gene|nph       ---EFERLIDMYRAFD-----PEDRAQGIPPAN-------ESAIRNWLEQLLGDDDNPG-
2522|chp|nrc1       ADAEIDALVAMYDDFD-----PEDRAQGVPPVG-------ESRIREWVASLLEQD---G-
967|gene|hut        ---DREALVEMYKAFD-----SEDRAQGIPPVG-------EESIRRWLERVFEPD---C-
12222|gene|hma      --ADTESLVEMYLDFD-----PADRAQGIPPVK-------EEAIREWLDTILNGD---C-
2694|gene|hhi       --ADTESLVEMYLDFD-----PADRAQGIPPVK-------EEAIREWLETILDGD---C-
1064|gene|hwa       SEDEYEALVEMYRGFD-----SKDRAQGIPPGR-------EERIRKWLDNILSSE---C-
1911|gene|hla       TDEGYEALVEMYDAFD-----PADRAQGIPPGG-------EKRIREWLDAILGDD---C-
3860|gene|hbo       SDEEFESLVSMYDAFD-----PADRAQGIPPGQ-------ERRIRDWLDNILAEE---C-
                         :        *.     . .  :   .            :.  :  :         

10127|gene|hma      PQGPLLDAIGQLNGDAESTRHNGQAPLVVGGGIDGGAVEIPGDVSSQYITALLMAGAVSP
13187|hp|hma        -----LNVVVW-----------------HEDQAVGHSVLVP-Y-QDTSELAIFVHPDYQH
450|gene|hhi        -----LNVVAW-----------------HEEQSVGHAVLVP-Y-QDTSELAIFVHPDYQH
1712|gene|nph       -----INVIAW-----------------HDDEPIGHAMLIP-DRHGAYELAIFVLHEYQG
2522|chp|nrc1       -----FDVVAW-----------------HGEEIAGHATLVP-DDDATYELAIFVHQTYQG
967|gene|hut        -----LNTIAW-----------------HDGDAVGHAMLVP-DEEGASELAIFVLGSHQS
12222|gene|hma      -----VNVVAK-----------------HDDTVAGHATLVP-DNEDEHELAIFVLQAYQG
2694|gene|hhi       -----VNVVAK-----------------HDDTVAGHATLVP-DNEDEHELAIFVLQAYQG
1064|gene|hwa       -----LNVIAW-----------------DGLAVAGHATLVP-D-DESYELAIFVLQVYQQ
1911|gene|hla       -----LNVIAW-----------------CGDEIAGHATLVP-D-DEAYELAIFVHQEYQR
3860|gene|hbo       -----LNVIAW-----------------DGDDAAGHATLVP-D-DDAYELAIFVLQEYQE
                         .:.: .                       * :  :*         *:::    . 

10127|gene|hma      DGIDIDLTTELKSSPYVDITLEVLDAFGVDAEKTDAGFTVDGGQTYVPDGGDYNVPGDFS
13187|hp|hma        AGIGSQL-------------IRVLLGYGQENGLDRVWLSVS-------------------
450|gene|hhi        AGIGSQL-------------IRVLLGYGQENGLERVWLSVS-------------------
1712|gene|nph       SGIGTEL-------------IQALLGAGREEGVERVWLTVE-------------------
2522|chp|nrc1       AGIGTEL-------------INALLGHAQASGAALVWLSVE-------------------
967|gene|hut        AGIGTEL-------------LQTLLGYGKDSGIDRVWLTVE-------------------
12222|gene|hma      AGIGTAL-------------VETLLGQGQSKGIDHVWLTVE-------------------
2694|gene|hhi       AGIGTAL-------------VETLLGHGQAEGIDHVWLTVE-------------------
1064|gene|hwa       AGIGTHL-------------IEALLGHGITSDITQVWLTVE-------------------
1911|gene|hla       AGIGTHL-------------IRGLLGYGQAEGIQKVWLTVE-------------------
3860|gene|hbo       AGIGTLL-------------IKSLLGHGAENSVKKVWLTVE-------------------
                     **.  *             :  * . .       . ::*.                   

10127|gene|hma      SMSYLLAAGALAAEDGLQVTSAFPSAQGDAAIVDILDRMGADLDWDEEHGEITVSQSELT
13187|hp|hma        -------------------------------------------NTN----HVARALYESV
450|gene|hhi        -------------------------------------------NTN----HVARALYESV
1712|gene|nph       -------------------------------------------RWN----TPATALYRKV
2522|chp|nrc1       -------------------------------------------RWN----RPAVALYEKV
967|gene|hut        -------------------------------------------RWN----EPAIGLYQKV
12222|gene|hma      -------------------------------------------RWN----DPAISLYEKV
2694|gene|hhi       -------------------------------------------RWN----DPAISLYEKV
1064|gene|hwa       -------------------------------------------RWN----NAAVGLYEKV
1911|gene|hla       -------------------------------------------RWN----RAAVSLYKKI
3860|gene|hbo       -------------------------------------------RWN----RPAVGLYKKI
                                                                 :      : .     

10127|gene|hma      GIEVGVEDTPDLLPTIATLGAAADGVTRITDAEHVRYKETDRVSAMAEELTKMGAEVEEH
13187|hp|hma        GFETIAKERVEM---------------------------------------EMQRAL---
450|gene|hhi        GFETIAKERVEM---------------------------------------EMERAL---
1712|gene|nph       GFESTGDGGFEI---------------------------------------EMAARLVDE
2522|chp|nrc1       GFETASAESFEM---------------------------------------EMAIRLNDD
967|gene|hut        GFEIRNTESFEL---------------------------------------EMAIRIADS
12222|gene|hma      GFEISSAESFEI---------------------------------------EMAIRI---
2694|gene|hhi       GFEISSAESFEI---------------------------------------EMAIRL---
1064|gene|hwa       GFEVSDSESFEL---------------------------------------QMGINLDNA
1911|gene|hla       GFETSNAESFEL---------------------------------------EMGLRLNPD
3860|gene|hbo       GFETSNSESFEM---------------------------------------EMTLRLTES
                    *:*       ::                                       :*   :   

10127|gene|hma      QDELFVYGADSDLVGTTVEGRADHRIIMSLAVAGLVADGETTVTGAEHVDVSFPDFFDVL
13187|hp|hma        ------------------------------------------------------------
450|gene|hhi        ------------------------------------------------------------
1712|gene|nph       ------------------------------------------------------------
2522|chp|nrc1       TG----------------------------------------------------------
967|gene|hut        SGDDSASEAANTGTDSASDADDDAEREPDDEP----------------------------
12222|gene|hma      ------------------------------------------------------------
2694|gene|hhi       ------------------------------------------------------------
1064|gene|hwa       ETY---------------------------------------------------------
1911|gene|hla       GDGDGNAGGDGDEDEDDQ------------------------------------------
3860|gene|hbo       AD----------------------------------------------------------
                                                                                

10127|gene|hma      DSLGAAVEQ
13187|hp|hma        ---------
450|gene|hhi        ---------
1712|gene|nph       ---------
2522|chp|nrc1       ---------
967|gene|hut        ---------
12222|gene|hma      ---------
2694|gene|hhi       ---------
1064|gene|hwa       ---------
1911|gene|hla       ---------
3860|gene|hbo       ---------