HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0489COG1967arCOG02178hypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0489 nrc1 VNG1852 vng1852 no entry
cHOG0489 hmu HMUK1525 Hmuk_1525 Protein of unknown function DUF63
cHOG0489 hma RRNAC3430 hypothetical protein
cHOG0489 hwa HQ3204A hypothetical protein
cHOG0489 hla HLAC1931 Hlac_1931 Protein of unknown function DUF63
cHOG0489 hbo HBOR09690 Hbor_09690 predicted membrane protein, COG1967
cHOG0489 hut HUTA2997 Huta_2997 conserved hypothetical protein
cHOG0489 hvo HVO_2611 HVO_2611 membrane protein putative
cHOG0489 nph NP3188A hypothetical protein
cHOG0489 hhi 3073 HAH_3073 hypothetical protein
cHOG0489 hhi 657 HAH_0657 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


3073|hp|hhi        ----MSDRAGGSRQPALGSVAKPSIRGIAVADLSAVLGAVVWLAMTVTGELAAIERALAL
3188|hp|nph        -----MVLPSDFALPAL-----PYLAALALGGV-VAVVLLYRRRPPVTE-----RTVAAL
3204|hp|hwa        ----MVIFPDGFALPAI-----PYLLTIIFAGG-VVAYAAIRQRPTVTS-----SRVLAL
1931|gene|hla      MVGDLPFLPAGTTLPPA-----PYLLVVLLATG-GVVAALRRRRPRVTG-----RRVLAL
1852|hp|nrc1       -MDTIAVLPSGFALPPL-----PHLLAVAALAA-AVLVGLRRDPPTVDG-----RAVLAL
9690|hp|hbo        ----MAILPEGFALPPL-----PYLVGLLVAVG-VVVAAVARRRPEVTP-----QRILAF
2611|hp|hvo        ----MAILPEGFALPPL-----PYLVALVAGLV-GVGVGLTRTRPTVTP-----AHVLAL
2997|chp|hut       ----MALLPSGLVVPAL-----PYLLVLGLGTL-LTTLLLLGFEPPVGK-----LHVLAL
13430|hp|hma       -----MVLPSGLALPPL-----EYTVALLAGTL-VVTALLYALEPPINQ-----RTVVAL
657|hp|hhi         -----MVLPSGLALPPL-----EYTVALLAGTL-VVTALLYALEPPIDQ-----RTVVAL
                           . .   *.           :       .          :           *:

3073|hp|hhi        APLVLVPLALRTAVT-----GAFEAPVSRLTTTAIWLQPVGALLFAVSLVVP---SPALL
3188|hp|nph        APWMAAGGTLYALYQ----AGAAPEPLAPLFSAPAVYVSVGVLAGGVWAGVADRDGSTWS
3204|hp|hwa        APWMALGAALHVQYV----LSALPPAIRPLAGTPAVYAIVTIAAIGTWVSLD-----LLV
1931|gene|hla      APWMALGSAAHVLYV----VDALPPLLSPFAGSPTVYLTVGSLAGAAWLVAD-----ATR
1852|hp|nrc1       APWMVAGSSLYACHQ----LGLYPSAVAPVFGSPIVYATTAAAAGATWLAVR-----RFG
9690|hp|hbo        VPWMILGSAVHVLYV----VNALPPVIHPLGGTPAVYLSVGVLGIGTFVAAA-----EWA
2611|hp|hvo        VPWMVSGSALHVLYV----VDALPPAVEPLAGTPAVYLSVAVVAGATWLALD-------A
2997|chp|hut       LPWMAIGGMAHGFYQIPQPPGLYPEWVGPLFGAPAVYVTTYVVVAAVWLLLI-LLGTAIG
13430|hp|hma       TPWMALGGALHAFHQ--PPIEAYRPVVTPLFGAPAVYLTTFVTLGVVWVTLT-LFSVRRG
657|hp|hhi         TPWMALGGALHAFHQ--PPIEAYRPVVAPLFGAPAVYLTTFVTLGVVWITLT-LFSVRRG
                    * :                      :  .  :.     .      .             

3073|hp|hhi        AAALATPWLAVTGLLGLAALARIRVRSGLTLPETAIDAGFAYVSVGAVALL--LAHLDLT
3188|hp|nph        LTGAAGPLAASGSVLLAAALVAAALAETPD-TMG-TSAAGSAVILAASIAATAVAWVLLS
3204|hp|hwa        TSAYIAQILAGVGVV--AALIAIAGVIAIN-PTS-LRVTVSIIGIGVSVILSGGVWVMLT
1931|gene|hla      PDR-VPAVLAVAGTLLLAPVVAVAVSTGLS-PE---GARWSTIALVLTIPIAGAVWVGLT
1852|hp|nrc1       ARPQV--LLAGVGAVAAAVPITAALARGWT-AGT-LTLAWPLGAVGAALVLTAGSWRLLA
9690|hp|hbo        EEALV-PLLTGVGTVLSAVAVAAAFLVGAS-EGT-LAPVVPAIGLVVATVVSAGAWVILT
2611|hp|hvo        ADLASPQTLAAPGLLVAAGLAGFALFIGLA-AGT-LSVVWPGTALVAALVVTPLTWRVVT
2997|chp|hut       KLDRVVTYLGATGVGVLIVFLGAMVWQGIG-PGLSFTPLWPTVAFLISLALTAVIYFLVS
13430|hp|hma       HSETISRNLGYIGIGLLTVLLVIAVVMALE-SGL-LGLIWPTIAVIVATVVTAVTVLAVA
657|hp|hhi         HSETISRNLGYIGIGLLTVLLVIAVVMALE-SGL-LGLIWPTVAVVVATVVTAVTVLAVA
                               .                           .   .             ::

3073|hp|hhi        FWFDRVIIRLTAVH----FHYAGFVLPVAAGLTGRHLGDRSRGFRTVAGVILVGPALIAV
3188|hp|nph        RTA--EVSATGAVGVLAVFGHTLDGISTAVGYDLLGFGEQTPLSRIILEAGAALP--PDI
3204|hp|hwa        RIVP-KTQLTAPMGTFAVFGHTLDGVSTTIGIDLLGFGERTPLSALIIEFASGLPTDAII
1931|gene|hla      RLRP-ETAITGGVGALAVFAHALDGVSTAVGTTHLGFGERTPVSRILLEIGG-LPSLPVV
1852|hp|nrc1       RIRPTDTRAVGVAGVLAVFGHALDATSTAVGVDALGYGEQTPLSTAIIELARALPTAPVV
9690|hp|hbo        RVLP-DARITAPVGILTVFGHALDAVSTAVGIDLLGFSERTPLSRAIIEFAATLPTEPFF
2611|hp|hvo        RLAP-EAAAAGSLGLLALFGHALDALSTAVGVDVLGFGERTPLSRVILDAAAALPTAEVI
2997|chp|hut       LRWTGVVARTGIAGAVVLFAHTFDGVITMIGKDVLEGGERTPIPAMIMDVAGSLPTAPYL
13430|hp|hma       LWRTPVVVRMRYAAPTVVFAHMLDGVSTAVGADVIGITERTPIPARIMEFAGTLPTAPYL
657|hp|hhi         LWRTPVVVRMRYAAPTVVFAHMLDGVSTAVGADVIGITERTPIPARIMELAGTLPTAPYL
                                     * :      .  *       :.:     :       *    .

3073|hp|hhi        GIAFSPLVEVVAVSLFTVAVAAFGVVVLRRVVPTCSRPQRLLLGISAVALPISMALALGY
3188|hp|nph        GGGW-------LFALVKIALGGAIVVLFESYVREAPAEGYLVLGLVA---------AVGF
3204|hp|hwa        GSGW-------LFVVVKLLIVSVVVWVFADIADTAPAQSNILLAIIS---------AVGF
1931|gene|hla      GEGW-------LFLLVKLAVASAVVWLFAGYIRETPGEGYLLLGFVA---------AVGL
1852|hp|nrc1       GGGW-------LFVVVKLALAAGVVVLLAESVRDRPQEGTAILGLVA---------AVGL
9690|hp|hbo        GTVW-------LFVLVKLVIVSGIVALFADYVREDPTEGNLLLGFVA---------AVGL
2611|hp|hvo        GVGW-------LFVLVKLAVAGFVVALLADYVREDPTEGSLLLGLVA---------AVGL
2997|chp|hut       GSGW-------LFLLVKVLLATLVIITFAEYIEERPARGHLLLVIIT---------AVGA
13430|hp|hma       GKGW-------LFVFVKLLVAIGVVFLLDDYLEEDPVEASLLLAVVT---------AVGI
657|hp|hhi         GKGW-------LFVFVKLLVAIAVVFLLDDYLEEDPVEASLLLALVT---------AVGI
                   *  :        . ...: :    :  :       .     :* . :         *:* 

3073|hp|hhi        GVSTFTGRSLGLTISTMVALHGSLNAFGFGLCATLGWRLSVQ
3188|hp|nph        G-------------------PGFHNLVLFALL----------
3204|hp|hwa        G-------------------PGVHNLLLFSVAG---------
1931|gene|hla      G-------------------PAAHNLLLFAVAA---------
1852|hp|nrc1       G-------------------PGVHNVVLFIAANPTGF-----
9690|hp|hbo        G-------------------PGVHNLILFTILGGA-------
2611|hp|hvo        G-------------------PGVHNLLLFAIAG---------
2997|chp|hut       G-------------------PAVNNFVLFTLG----------
13430|hp|hma       G-------------------PATNNIVLFLFSPV--------
657|hp|hhi         G-------------------PATNNIVLFLFSPV--------
                   *                    .  * . *