HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0488COG0195arCOG01760Transcription elongation factortranscription termination-antitermination factor

HOG Organism Gene ID Name Annotation
cHOG0488 nrc1 VNG2661 nusA transcription termination-antitermination factor
cHOG0488 hmu HMUK0511 Hmuk_0511 NusA family KH domain protein
cHOG0488 hma RRNAC2426 nusA transcription elongation factor NusA-like protein
cHOG0488 hwa HQ3392A nusA transcription elongation factor NusA-like protein
cHOG0488 hla HLAC0103 Hlac_103 NusA family KH domain protein
cHOG0488 hbo HBOR28200 Hbor_28200 NusA family KH domain protein
cHOG0488 hut HUTA0780 Huta_0780 NusA family KH domain protein
cHOG0488 hvo HVO_0351 HVO_0351 NusA family KH domain protein archaeal
cHOG0488 nph NP0118A nusA transcription elongation factor NusA-like protein
cHOG0488 hhi 2858 nusA putative transcription elongation factor NusA protein
MUSCLE (3.6) multiple sequence alignment


780|gene|hut        MTISLSDDERRAIVVAEEIADVTIRDCLIDDEHDRIAFVVKAGEVGKAIGRDGETVARIE
118|gene|nph        MAVTLTDEARRYIALFDEETDVAATDCVVDEEYDRIAFVVPPGTMGQAIGPGGDHVATVE
12426|gene|hma      MRVELSDEARRLVALFEDEAAVTVRDCVVDEDHDQVVYLVKRGQMADAIGPGGQTVERVE
2858|gene|hhi       MRVELSDEARRLVALFEDEAAVTVRDCVVDEDHDQVVYLVKRGEMADAIGPGGQTVERVE
2661|gene|nrc1      MTIRLSDEARQLIAVFETETDATAVDCLPDD--DRVVYVVTAGEMGAAIGDGGSRVDALE
3392|gene|hwa       MRITLSDEARQYIAYFESATDATVRDCLLFD--ERVVLLIAAGEMGTAIGPGGKHVRAVE
103|gene|hla        MYVELSDEARRYIGRFDELTGVAPKDCLVEG--DRLVFLVPAGKMAAAIGQAGETVEEAE
28200|gene|hbo      MTVTLSDTARQYIALFEDETEAVARDCLVFD--DRVVILVAAGQMGQAIGPRGQHVHAVE
351|gene|hvo        MKVTLSDTARRFIALFEEETEATAHDCLVFD--DRVVFLVAAGDMATAIGPGGRTVQSVE
                    * : *:*  *. :   :  : ..  **:     :.:. ::  * :. ***  *  *   *

780|gene|hut        DRLGRDVTLVEDAPTPEGFVANALAPAAVYDVTIEERDGERVAFADVDEADTGAAIGTEG
118|gene|nph        SKVGRDVTVIEGAETAADFVANALAPAAVYNVTISEN-DTTVAYAEVDENDRGVAIGADG
12426|gene|hma      ERLGREVKLVEAAETAEDFVANALAPAAVYNVTVSEN-DDTVAYVEVAQEDRGAAIGREG
2858|gene|hhi       ERLGREVKLVEAAETAEDFVANALAPAAVYNVTVSEN-DDTVAYVEVAQEDRGAAIGREG
2661|gene|nrc1      ATLGRSVVLVEDAPTAEGFVANALSPAAVYNVTVSEN-DTTVAYAEVAHEDKGVAIGADG
3392|gene|hwa       DDIGTTVELVEDAETARAFVENALAPAAVRHVTISEQGGECVAYVEIPDPDRGIAIGADG
103|gene|hla        RRLAKSIELVEDADTPEAFVASALAPAAVNAVTISEQ-NDRVAYVEVPEPDRGVAIGADG
28200|gene|hbo      EKIGRSVELVEDADTTEAFVESMLAPAAVRHVTISEQ-DDRVAYVEVENADRGVAIGKEG
351|gene|hvo        RQLGRTVELVEDADTPEAFVASALAPAAVRHVTLSRQ-NDTVAYVEVAEADRGVAIGASG
                      :.  : ::* * *.  ** . *:****  **:. . .  **:.::   * * *** .*

780|gene|hut        RTIELARRLAGRHFEIDDIQLA
118|gene|nph        RNIDLARRLADRHFDIDDVELT
12426|gene|hma      RNIDAARQLAKRHFEIDGIELT
2858|gene|hhi       RNIDAARQLAKRHFEIDGIELT
2661|gene|nrc1      TNIETAKELAARHFDIDDIQLT
3392|gene|hwa       KNIHTARKLVRRHYEIDDIQLT
103|gene|hla        ANIETARTLAKRHYDIDDIQLT
28200|gene|hbo      RNIETARTLAERHHGVDDIQLT
351|gene|hvo        KTIDTARELARRHYDIDDIQLT
                     .*  *. *. **. :*.::*: