HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0487COG0180KOG2713 KOG2145arCOG01887/3Tryptophanyl-tRNA synthetasetryptophanyl-tRNA synthetase

HOG Organism Gene ID Name Annotation
cHOG0487 nrc1 VNG2208 trpS1 tryptophanyl-tRNA synthetase
cHOG0487 hmu HMUK0665 Hmuk_0665 tryptophanyl-tRNA synthetase( EC:6.1.1.2 )
cHOG0487 hma RRNAC2965 trpS tryptophanyl-tRNA synthetase
cHOG0487 hwa HQ1048A trpS tryptophanyl-tRNA synthetase
cHOG0487 hla HLAC1863 Hlac_1863 aminoacyl-tRNA synthetase class Ib
cHOG0487 hbo HBOR03060 Hbor_03060 tryptophanyl-tRNA synthetase( EC:6.1.1.2 )
cHOG0487 hut HUTA1670 Huta_1670 Tryptophan--tRNA ligase
cHOG0487 hvo HVO_2951 HVO_2951 trpS tryptophanyl-tRNA synthetase
cHOG0487 nph NP0442A trpS tryptophanyl-tRNA synthetase
cHOG0487 hhi 225 trpS tryptophanyl-tRNA synthetase
MUSCLE (3.6) multiple sequence alignment


2208|gene|nrc1      ---MTSDD----------------------------------------------------
1048|gene|hwa       MTRDTEDDITNTGSETETETKTETETKTETDADIDIETKSGYAIDIGTDVDTHNDDIDVT
1670|gene|hut       ---MTRDSHTDDEPTDDRRREQAFPRLR--------------------------------
12965|gene|hma      ---MTTDDSHHDDASPDEDRRQSGGTWREPDARSGGEPVL--------------------
225|gene|hhi        ---MTTDDSHHDDASPDEDRRQSGGTWREPDARSGGESVL--------------------
2951|gene|hvo       ----MTDDEPAE------RIR---------------------------------------
1863|gene|hla       -----MDED---------TPR---------------------------------------
442|gene|nph        ----MTDDDPHTEPVA--PAR---------------------------------------
3060|gene|hbo       ---MIRDDDIETDASVREDAR---------------------------------------
                          *.                                                    

2208|gene|nrc1      --------TDD----TAGADDVALDPWGSATISDYRALFDEFGIEAFEDVLDGVPTPHSL
1048|gene|hwa       ALSTATAVSDGG---AAGADDVALDPWGSSTVSDYQKLFTEFGIETFDDVLPAVPNPHYL
1670|gene|hut       --------TDGGA--AAGADDTTLDPWGSSTVADYRNLFEEFGIEEFDEILPDVPAPHYL
12965|gene|hma      --------PDGGTE-AEGADEATLDPWGSSTIADYRKLFEQFGIEEFDEVLPEVPNPHYL
225|gene|hhi        --------PDGGTE-AEGADEATLDPWGSSTIADYRKLFEQFGIEAFDEVLPEVPNPHYL
2951|gene|hvo       --------TDGGT--AEGADDVALDPWGSSTVSDYRKLFEEFGIEEFDEVLDEVPNPHYL
1863|gene|hla       --------TDGGTERAEPTEDVALDPWGSASVGDYADLFEEFGIEAFDDVAESVADPHYL
442|gene|nph        --------TDGGT---KGADDVTLDPWGSSTVADYRKLFEEFGIETFDALLADVPNPHYL
3060|gene|hbo       --------TDGGTS-AEGADDVALDPWGSSTISDYRKLFEEFGIEEFDEVLSDVPNPHYL
                            .*.       :::.:******:::.**  ** :**** *: :   *. ** *

2208|gene|nrc1      MRRAIIFGHRDYRRVAAAMRNDEPFAALSGFMPTGDPHIGHKMVFDELIWHQQQGGDAYA
1048|gene|hwa       MRRGVIFGHRGYDPVAEALQNNDPVAVLSGFMPTGDPHIGHKLVFDEIIWHQQRGADAYA
1670|gene|hut       MRRGVIFGHRDYRPVARAMRDGDPFAVLSGFMPTGDPHIGHKLVFDEIIWHQRQGGDAYG
12965|gene|hma      MRRGVIFGHRDYRPVADAMRNDDPFAALSGFMPTGDPHIGHKLVFDEIIWHQQQGGDAYA
225|gene|hhi        MRRGVIFGHRDYRPVAEAMRNDDPFAALSGFMPTGDPHIGHKLVFDEIIWHQQQGGDAHA
2951|gene|hvo       MRRGVIFGHRDYRPVLDAMRNGDDFAVLSGFMPTGDPHIGHKLVFDEIIWHQEQGGDAYG
1863|gene|hla       MRRGVIFGHREYDAVAEAMANDEPFAALSGFMPTGDPHIGHKLVFDEIIWHQQQGGDAFG
442|gene|nph        MRRGVIFGHRDYEPVAEAMANDEPFAALSGFMPTGDPHIGHKLVFDELIWHQQQGGDVYA
3060|gene|hbo       MRRGVIFGHRDYRPVAEAMRDGDPFAVLSGFMPTGDPHIGHKLVFDEIIWHQQQGGDAYG
                    ***.:***** *  *  *: :.: .*.***************:****:**** .*.*...

2208|gene|nrc1      LIADLEAHSARGLDWAEIDEHAEDYLLSLLALGFDADEGELYRQSTNRELQDLAFELGIE
1048|gene|hwa       LIADLEAHAARGLSWSEIDDHARDYLLSLLALGFDPESGELYRQSENRELQDFAFELGSK
1670|gene|hut       LIADLEAHAARGLTWDEIDEHARDYILSLLALGFDPEEGTLYRQSENRELQDLAFELGAE
12965|gene|hma      LIADLEAHSARGLSWDEIDEHATNYLLSLLALGFDPDEGTLYRQSDNREVQDLAFELGAE
225|gene|hhi        LIADLEAHSARGLSWDEIDEHATDYVLSLLALGFDPDEGTLYRQSDNREVQDLAFELGAE
2951|gene|hvo       LIADMEAHSARGIPWDEINEHSRDYLLSLIALGFDPEEGELYRQSDNDRLQRLAFELGGK
1863|gene|hla       LIADLEAHSARGMSWDEIDEHARNYLLSLLALGFDAEEGELYRQSDNREVQDLGFELGSK
442|gene|nph        LIADLEANSARGMSWTEIDEHAESYLLSLLALGFDPDEGELYRQSENDELQELAFELGAK
3060|gene|hbo       LIADLEAHSARGMTWEEIDKHARDYLLSLLALGFDPEEGELYRQSDNRQLQDLSFELGSK
                    ****:**::***: * **:.*: .*:***:*****.:.* ***** *  :* :.**** :

2208|gene|nrc1      ANTSEFEAIYGFGGDTDVSHMQSVVTQMADILYPQL-DAPKPTVIPVGPDQDPHVRFARD
1048|gene|hwa       ANFSEFEGIYGFDSETNVAYMQSVITQMADILYPQL-EEPKPTVIPVGPDQDPHVRFARD
1670|gene|hut       ARFAEFEGIYGFDGETDVSHMQSVVTQIADILYPQL-EEPKPTVIPVGPDQDPHMRLARD
12965|gene|hma      ANFSELQAIYDFDGETDISHMQSVVTQMADILYPQL-DEPKPTVIPVGPDQDPHMRLARD
225|gene|hhi        ANFSELQAIYDFDGETDVSHMQSVVTQMADILYPQL-DGPKPTVIPVGPDQDPHMRLARD
2951|gene|hvo       ANFSEFQSIYGFDGETNVSHMQSVVTQMADILYPQL-DDPKPTVIPVGPDQDPHVRFARD
1863|gene|hla       ANFSEFEAIYGFDGETNISHMQSVITQTADILYPQLVDEPKPTVIPVGPDQDPHVRLTRD
442|gene|nph        ANFSEFQGIYGFDGETSVSHMQSVVTQMADILYPQL-DEPKPTVIPVGPDQDPHVRLARD
3060|gene|hbo       ANFSEFEAIYGFDSGTNVSHLQSVVTQMADILYPQL-DEPKPTVIPVGPDQDPHVRLARD
                    *. :*::.**.*.. *.::::***:** ******** : ***************:*::**

2208|gene|nrc1      LAERTRYFKVTEAFASVAFDDDERPLVRAAYDARSQYAADTD----QPRCTEAADWL---
1048|gene|hwa       LAARMRFFKVTKAYASFELTESERELVAAVYDERETYAEDVS----RPRCAEAATWLVDN
1670|gene|hut       VAARMRYFGVTKAYASFETDDEERALLAEAYETL-AGDHPGE----TIRCGDAATYL---
12965|gene|hma      LAARMRYFGVTEAFASFEADGVERTLLRQAYDAREEYAEDAD----RPRCGEAADWL---
225|gene|hhi        LAARMRFFGVTEAFASFEADAVERTLLRQAYDAREEYAEDVD----RPRCGEAADWL---
2951|gene|hvo       LAIRMRFFKVTEAFASFELDDAERPLVAAAHDAREAYAEDAD----MPRCGEAAEWL---
1863|gene|hla       LATRVRYFKVTEAFASFELNDDERQLVRAAYDALAAGDESDGDAEVDVRCGDAAEWL---
442|gene|nph        LASRMRYFKVTKAYASFELEDAERDLVARAYEAL---ADNED----DVRCSDAAAWL---
3060|gene|hbo       LAARMRFFKVTEAYASFELTDAERDLVASLYETLDPADFDDD----DLRCVHVAQFL---
                    :* * *:* **:*:**.     ** *:   ::                **  .* :*   

2208|gene|nrc1      -----------------AAEPAAADGVD---AATAESVVQKLENAGMEPLRPRVRFFDRQ
1048|gene|hwa       LVTPVDNGSDDARNEDTDVSPDTLGIIVP--DAVIESTIKKLENAGMEPLRPRVRFLDAN
1670|gene|hut       ---------------DNERDRDATDGG----AMTKDRLITMLREAGKEPLRPRVRFLDRN
12965|gene|hma      ----------------RDHQPAP--------ADARESIVAKLDEAGKEPLRPRIRFLDRN
225|gene|hhi        ----------------RDHQPAP--------ADARESVVAKLAEAGKEPLRPRIRFLDRN
2951|gene|hvo       ----------------ADADLDAAGVLVS--ESVRESAVEKLENAGMEPLRPRIRFFARQ
1863|gene|hla       ----------------ADYEPPETDSEATDLVAAKSTALDKLRAGGKEPLRPRVRFFDRN
442|gene|nph        ----------------ESEAPD---------DPALESAVAKLDAGGKEPLRPRVRFFDRN
3060|gene|hbo       ----------------DGVTPEELDVVVD--AETISSAQTKLNEAGMEPLRPRVRFLDAN
                                                     . .     *  .* ******:**:  :

2208|gene|nrc1      ATDEAFTALIDEIAGEKRVFEGHVDAFELSAETARDLALAVEVDHGGYGFVPPSSVYHRF
1048|gene|hwa       ATDEAFEALITAIDGEKRRYDEHIDAFDLSAADATDLAREVETNNGGYGFVAPSSIYHRF
1670|gene|hut       ATEEAFEALIEAIDGEKRVYDEHIDAFELDHEAAAALAREVELANGGYGFLAPSSIYHRF
12965|gene|hma      ATDAAFEALIEAIDGEKRVYDEHIDTFDLDHAEAEELARQVELDNGGYGFQPPSSIYHRF
225|gene|hhi        ATEAAFEALIEAIDGEKRVYDEHIDTFDLDHAEAEELARQVELDNGGYGFQPPSSIYHRF
2951|gene|hvo       ATDEAFEALIEDIEGEKRRYDQHIDAFDMDVDEAEDLAREVEAHHGGYGFIAPSSIYHRF
1863|gene|hla       ATEEAFEALIEAVDGEKRVFEGHVDAFDLTREEAEALARDVEIDHDGFGFRQPSSIYHRF
442|gene|nph        ATADAFEALIEAIDGEKRVYEGHIDSFELDREAAAELAREVELDHGGYGFRPPSSIYHRF
3060|gene|hbo       ATDEAFDALVEAIDGEKRRYDEHIDAFDLSFEAADELAREVEVEHGGYGFVAPSSIYHRF
                    **  ** **:  : **** :: *:*:*::    *  **  **  :.*:**  ***:****

2208|gene|nrc1      MTGLTGGKMSSSEPASHISLLDDPETGADKVAAATTGGRDTAAEQRERGGEPDDCPVYEL
1048|gene|hwa       MTGLTGGKMSSSVPASHISLLDDPETGYEKVKSATTGGRETAEKQRELGGKADECPVYEL
1670|gene|hut       MTGLTGGKMSSSVPESHISLLDDPEDGYDKVRAATTGGRETAEEQRELGGKPDECPVYEL
12965|gene|hma      MTGLTGGKMSSSIPASHISLLDDPEDGYDKVKSATTGGRSTAEEQREKGGKADECPVYEL
225|gene|hhi        MTGLTGGKMSSSIPASHISLLDDPEDGYDKVKSATTGGRSTAEEQREKGGKADECPVYEL
2951|gene|hvo       MTGLTGGKMSSSIPASHISLLDAPEEGYDKVKSATTGGRDTADEQRELGGEADKCPVYEL
1863|gene|hla       MTGLTGGKMSSSVPASHISLLDDPEDGYDKVRAATTGGRDTAAEQRELGGEADECPVYEL
442|gene|nph        MTGLTGGKMSSSDPASHISLLDDPEDGYDKVKAAATGGRETAEKQRELGGEPDGCPVYEL
3060|gene|hbo       MTGLTGGKMSSSIPASHISLLDDPEDGYNKVKSATTGGRETAEKQRELGGEADKCPVYEL
                    ************ * ******* ** * :** :*:****.** :*** **:.* ******

2208|gene|nrc1      YAYLLAGDDDALAEEVYAECANGDRLCGGCKEQAADLMAQFLETHQENREAARDVLAELD
1048|gene|hwa       YAYLLANDDDTLATQVYDECVSGDRLCGSCKEQAAKLMQAFLEEHQEKRKEVESLLEDAD
1670|gene|hut       YAYLLADDDDEFATEVYEECAGGERLCGGCKEQAAELMESFLEDHQEKREEWADRLDELD
12965|gene|hma      YAYLLSGDDDEFAKEVYDECVGGERLCGGCKEQAAELMEQFLEEHQEKRAEWEDRLEELD
225|gene|hhi        YAYLLSGDDDEFAKEVYDECVGGERLCGGCKEQAAELMEQFLEEHQEKRAEWEDRLEELD
2951|gene|hvo       YAYLLTGDDDELAKEVYDECVGGERLCGGCKEQAATMMREFLEDHHEKREEAAEVLDSLD
1863|gene|hla       YAYLLAGDDDELTKTVYSECVNGERLCGGCKEQAAELMSEFLEDHQEKRAEAEELLDDLD
442|gene|nph        YAYLLAGDDDGLATEVYDECIGGDRLCGGCKEQAAELMAEFLDDHQEKREEARELLADLD
3060|gene|hbo       YAYLLSGDDDEFAKEVYDECVGGERLCGGCKEQAAELMRAFLEDHQEKREEMEELLDDLD
                    *****:.*** ::  ** ** .*:****.****** :*  **: *:*:*    . * . *

2208|gene|nrc1      IDLDSARV----------------
1048|gene|hwa       ISLISDRRTVAPSDTADSTDNENT
1670|gene|hut       IDFDSSRKRT--------------
12965|gene|hma      IDLDSDRAPTSAD-----------
225|gene|hhi        IDLDSDRAPTSAD-----------
2951|gene|hvo       IDLETERRGVAAEH----------
1863|gene|hla       IDLDSDRRGTGGEH----------
442|gene|nph        IELESSRR----------------
3060|gene|hbo       ISTDSQRRGVAPSDD---------
                    *.  : *