HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0486COG0015KOG2700arCOG01747Adenylosuccinate lyaseadenylosuccinate lyase

HOG Organism Gene ID Name Annotation
cHOG0486 nrc1 VNG0415 purB adenylosuccinate lyase
cHOG0486 hmu HMUK3158 Hmuk_3158 adenylosuccinate lyase( EC:4.3.2.2 )
cHOG0486 hma RRNAC0192 purB adenylosuccinate lyase
cHOG0486 hwa HQ1662A purB adenylosuccinate lyase
cHOG0486 hla HLAC0921 Hlac_921 transposase IS4 family protein
cHOG0486 hla HLAC0924 Hlac_924 adenylosuccinate lyase
cHOG0486 hbo HBOR22730 Hbor_22730 Adenylosuccinate lyase( EC:4.3.2.2 )
cHOG0486 hut HUTA0652 Huta_0652 adenylosuccinate lyase
cHOG0486 hvo HVO_1084 HVO_1084 purB adenylosuccinate lyase
cHOG0486 nph NP1658A purB adenylosuccinate lyase
cHOG0486 hhi 942 purB adenylosuccinate lyase
MUSCLE (3.6) multiple sequence alignment


921|gene|hla        ------------------------------------------------------------
415|gene|nrc1       MNSHTNGVFRASVAGKCTSSCVGGIGRLLRRAPPVGGMTDDHALYAVSPLDGRYSGRTDA
1662|gene|hwa       ------------------------MDNLSRDNP----------LAAVSPLDGRYSSRTAP
1658|gene|nph       ---------------------------MTERGP----------LYAVSPLDGRYARYTEP
652|gene|hut        ---------------------------MTDRDP----------LSAVSPLDGRYARYTDP
10192|gene|hma      ---------------------------MTERGP----------LAAVSPLDGRYARYTEP
942|gene|hhi        ---------------------------MTERGP----------LAAVSPLDGRYARYTEP
924|gene|hla        ------------MTDDSEPAGDDDIAGLSRSDP----------LAAVSPLDGRYAARTAP
22730|gene|hbo      ------------------------MDDLSRSDS----------LAAVSPLDGRYAGRTAP
                                                                                

921|gene|hla        ---MSTSASILQEETSID-EF-------------------------FNVMATETLALFEH
415|gene|nrc1       LAPYVSEAALMRARVEVEAEYVLALADLDAVPLELVGDERTALRDAYKTFDAADADLVKR
1662|gene|hwa       LVSHTSEAALMRTRLRVEIEYLYALDALEPISFSLDPSDRDTLKTTVNSFDGDDAAMIKQ
1658|gene|nph       LTDYASEAALMCARVEVEVEYLIALADLDATPLSLTETTRENLRDCYREFDAEDADVIKQ
652|gene|hut        LVPYASESGLIRARVRVEVEYLLALADLDATPLEIDDDQRATLRAVYEDFDDEDAALVKQ
10192|gene|hma      LVPYASERALMRARVEVEVEYLIALADLDATPLSIDDGQRATLRALYEEFDDEDASVVKQ
942|gene|hhi        LVPYASERALMRARVEVEVEYLIALADLDATPLSIDDGQRATLRALYEEFDDEDASVVKQ
924|gene|hla        LSPYASEAALMRARTRVEVEYLIELAALDATPIALDEEAEAAFRAVYEEFSAEDARLIKA
22730|gene|hbo      LVPYASEAALMRARVRVEAEYLLALADLDATPLSLSDEERETVRGLYDSFDGDDARLVKR
                         :. .::     :: *:                            :      :.: 

921|gene|hla        LEFDFLEEFDV-------------------------FAPARR------GRTRDHHPPALF
415|gene|nrc1       IETEGALGHAATNHDVKAVEYFLRE-----------HAPARAHSWIHFGLTSEDVNNLAY
1662|gene|hwa       IEVEGAAGYSATNHDVKAIEYFLRI-----------QTPSYIHPWIHFGLTSEDINNLSH
1658|gene|nph       LETSGYGDYEATNHDVKAIEYFIRMYL---------PDEDEQGPWVHFGLTSEDVNNLAH
652|gene|hut        IETEGTETYDATNHDVKAVEYFLRERL---------PADLDAEQWLHFGLTSEDVNNLAQ
10192|gene|hma      LETEGYGEYSATNHDVKAIEYFIRLGM---------PDDLDAANWIHFGLTSEDVNNLAQ
942|gene|hhi        LETEGYGEYAATNHDVKAIEYFIRLGM---------PDDLDAANWIHFGLTSEDVNNLAQ
924|gene|hla        LEVEGAEGYAATNHDVKAVEYFLRVRLDGLDDSGTIADSEALYPWIHFGLTSEDVNNLAQ
22730|gene|hbo      LETEGAEGYSATNHDVKAVEYFVRT-----------ETPERVHPWIHFGLTSEDVNNLAH
                    :* .    . .                                     * * :       

921|gene|hla        RAFLHCYYKNVYGIRPVTRELQNTVVWLSCGFDRPP---------------------SRD
415|gene|nrc1       RLLVDGAITAVLT--PELRGLRDDLVSFAHDYADLPMLARTHGQPATPTTFGKEMAVYAA
1662|gene|hwa       RLLIRSGVKNVLV--PALRSLRDELVSLAQEYRKTPMLAQTHGQPATPTTFGKEMAVYAT
1658|gene|nph       RLLVKPAVEDVLV--PEIRSIRDALADSAREHRDVPMLARTHGQPATPTTYGKELAVYAA
652|gene|hut        RILVKPAVEDVLL--PALRDVRDALVELAQTYRDTPMLARTHGQPATPTTFGKEMAVYAS
10192|gene|hma      RLLVKPAAQEVLI--PELREIRDTLVEMAHTYADVPMLARTHGQPATPTTFGKEMAVYAS
942|gene|hhi        RLLVKPAAEEVLV--PELREIRDTLVEMAHTYADVPMLARTHGQPATPTTFGKEMAVYAS
924|gene|hla        RLLVKQAVSEAIV--PAIREVRDALVDLAQEHRGTPMLAHTHGQPATPTTFGKEMAVYAS
22730|gene|hbo      RLLAKPAVEEVLV--PAIEDVRDELTALAREHRATPMLARTHGQPATPTTFGKEMAVYAA
                    * :       .    *    :.: :.  :  .   *                        

921|gene|hla        AVDRFLTDLEHVVDEVFDRLVEQAACRGLLDLTYS-----------IDSTDV-------R
415|gene|nrc1       RLGRALARITDAVDGLTGKLAGASGTWAAHTAAFPDVDWRSFAARFVDSLGLAYAEPTTQ
1662|gene|hwa       RIGTAIGRITDANDTLTGKLAGASGTYAAHAAAYPDVDWRAFAQSFVTDLGLNHVKLSTQ
1658|gene|nph       RLGQALGRLEAAADGITGKLAGASGTYAAHEAAYPDVDWQAVSRSFVESLGLEWRALSTQ
652|gene|hut        RLGRALGRIQWATDGLSGKLAGASGTYAAHHAAYPDVDWPAFALGFVDSLGLDHEPLTTQ
10192|gene|hma      RLGQAIGRVERAAEGLSGKLAGASGTYAAHVAAYPDVDWPTFAESFVGGLGLEHEPLTTQ
942|gene|hhi        RLGQAIGRVERAAEGLSGKLAGASGTYAAHVAAYPDVDWPTFADSFVGDLGLEHEPLTTQ
924|gene|hla        RLGRALGRVVVANGDLSGKLAGASGTYAAHDAAYPDVDWRAFAESFVRGLDLEHTPLATQ
22730|gene|hbo      RIGQQLGRVKEAAATLSGKLAGASGTYAAHVAAYPDVDWRSFSRTFVTDLGLEHTALTTQ
                     :.  :  :  .   : ..*.  :.  .    ::.           : . .:       .

921|gene|hla        TMPADQ-----DASKGYDPTAEEY-----------YHGYGCTIVSTGQKI------PIAA
415|gene|nrc1       VNPCDDLTAVFDAVAGANGVLEDLAVDAWLYVSQRYLGQDAADGETGSSTMPHKVNPIDF
1662|gene|hwa       INPCDDLAALFDALCGVNNMIIDLDRDAWLYISNRYLGQQTTAGETGSSTMPHKVNPIDF
1658|gene|nph       VNPCDDLAAVFDALRGVNNVLRDLDLDMWLYVSDRYLGQKSVAGETGSSTMPHKVNPIDF
652|gene|hut        VNPCDDLATLFGALQGANRILLDLDLDAWLYVSDRYLGQRSVDGETGSSTMPHKVNPIDF
10192|gene|hma      VNPCDDLAVLFDALRGANNILLDLDLDVWLYVSDRYLGQEAVEGETGSSTMPHKVNPIDF
942|gene|hhi        VNPCDDLAVLFDALRGANNILLDLDLDVWLYVSDRYLGQEAVEGETGSSTMPHKVNPIDF
924|gene|hla        VNPCDDLAALFDALRGVNNILLDLDLDAWLYVSDRYLGQRTVEGETGSSTMPHKVNPIDF
22730|gene|hbo      VNPCDDLAALFDALRGVNNVLLDLDRDVWMYVSQRYLGQEATAGETGSSTMPHKVNPIDF
                      *.*:     .*  * :    :            * *   .  .**..       **  

921|gene|hla        EFTESKQAPEETAMRVTCDALAVEKPIWMLGDS----------AYDTLGWHDHLLAAGVV
415|gene|nrc1       ENAEGNLAKANSDLGFLGDSLTTSRLQRDLSDSTVKRNIGAAFAHCLLAYRK--LGDGLD
1662|gene|hwa       ENAEGNLSKATSDLRFLADYITNSRLQRDLSDSTVKRNIGAGFAHALIGYKK--TTDGLQ
1658|gene|nph       ENSEGNLTKANSDLTFLADYVTTSRLQRDLSDSTVKRNIGSAFAYCLIAYEK--TQRGLS
652|gene|hut        ENSEGNLSKANSDLDFLAGYVTNSRLQRDLSDSTVKRNIGGALAHCLIGYEK--LQRGLG
10192|gene|hma      ENSEGNLSKANSDLRFLGDYVTNSRLQRDLSDSTVKRNIGAAFAHCLIGYSK--CQNGLA
942|gene|hhi        ENSEGNLSKANSDLHFLGDYVTNSRLQRDLSDSTVKRNIGAAFAHCLIGYSK--CQNGLA
924|gene|hla        ENSEGNLSKANSDLTFLADYVTTSRLQRDLSDSTVKRNMGAALAHCLIGYSK--AGDGLA
22730|gene|hbo      ENSEGNLSKANADLTFLADYVTNSRLQRDLSDSTVKRNIGSSFAHCLIGYGK--TAAGLD
                    * :*.: :   : : .  . :: ..  . *.**          *:  :.: .     *: 

921|gene|hla        PVAPYNARNTDDPKDIEYRVEARIDEHSEDVQ--LKQSTLDETYNRRSGVERTNDAVKDC
415|gene|nrc1       AVTPNEAVLRED-------LRANPEVIGEAVQTILRREGHDDAYERVKALTRGERVSLDD
1662|gene|hwa       KVVPNQTVMQSE-------LESHPELIGEAVQTILRREGDVDAYERVKELTRGEDVALTD
1658|gene|nph       KVTPNEAVMQES-------LDDNPEVIGEAVQTILRREGDTEAYERIKALTRGQRATLAD
652|gene|hut        KVVPNETVMRED-------LEATPAVIGEAVQTILRREGYTDAYERVKEHTRGESITMAD
10192|gene|hma      KVVPNEQVMADD-------LAGTPEIIGEAVQTILRREGYADAYEQVKKATRGREVTIED
942|gene|hhi        KVVPNEQVMRDD-------LAATPEIIGEAVQTILRREGYADAYEQVKKATRGREVTIED
924|gene|hla        TVVPNETVMREE-------LAATPEVIGEAVQTILRREGDTDAYERVKDLTRGKRVTLDD
22730|gene|hbo      KVVPNEQVMREE-------LEAHPELIGEAVQTILRREGDAEAYERVKELTRGRDVTIED
                     *.* :    ..       :       .* **  *...   ::*:. .   *        

921|gene|hla        GLGHVRARGRVHARAQVFLALCLRLVIAITNDERGDNPGSTVITL-----
415|gene|nrc1       FKELFASLDIDADTRDELLALTPERYVGVAADIARDA-------------
1662|gene|hwa       FHDLFASLSVSESVRDELQALSPLTYTGYASELVDEVDETTDADAQDSYS
1658|gene|nph       FRELFDDLDVDESVKAELRALSPAGYTGIGAELVDELDN-----------
652|gene|hut        FEALFADLDVDPAVRDELEALTPASYTGIADELADVQ-------------
10192|gene|hma      FHDMFADLDVSDEVRAELEALTPTDYTGIAEQQADDS-------------
942|gene|hhi        FHDMFADLDVSDEVRAELEALTPTDYTGIAAQQADDI-------------
924|gene|hla        FRDLFDDLDVDEGVREELKALTPAGYVGVADELVDEIDE-----------
22730|gene|hbo      FRDLFDELDVDESVRAELRALSPATYVGLGDELVGDL-------------
                        .   .        : **      .   :