HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0485COG0081KOG1570arCOG04289Ribosomal protein L150S ribosomal protein L1P

HOG Organism Gene ID Name Annotation
cHOG0485 nrc1 VNG1105 rpl1p 50S ribosomal protein L1P
cHOG0485 hmu HMUK2186 Hmuk_2186 ribosomal protein L1
cHOG0485 hma RRNAC1415 rpl1P 50S ribosomal protein L1P
cHOG0485 hwa HQ2903A rpl1P 50S ribosomal protein L1P
cHOG0485 hla HLAC2535 Hlac_2535 ribosomal protein L1
cHOG0485 hbo HBOR12250 Hbor_12250 LSU ribosomal protein L1P
cHOG0485 hut HUTA0254 Huta_0254 ribosomal protein L1
cHOG0485 hvo HVO_2757 HVO_2757 L1P family of ribosomal proteins
cHOG0485 nph NP4452A rpl1P 50S ribosomal protein L1P
cHOG0485 hhi 1998 rpl1P 50S ribosomal protein L1P
MUSCLE (3.6) multiple sequence alignment


1105|gene|nrc1      MADNDIEEAVARALEDAPQRNFRETVDLAVNLRDLDLNDPSQRVDEGVVLPSGTGQETQI
2535|gene|hla       MAD-TIQEAVTLALDDAPERNFRETVDIAINLRDLDLNDPSNRIDESVVLPAGTGQETQI
2903|gene|hwa       MAD-TITDAVSRAIDEAPTRNFRETVDLAVNLRDLDLNDPSNRVDESVVLPAGTGQETQI
12250|gene|hbo      MAD-TIVDAVSRALDEAPERNFRETVDLAINLRDLDLNDPSKRVDESIVLPAGTGQETKI
4452|gene|nph       MAD-SIEDAVSRAMSESPERNFRETVDLAINLRDLDLADPNNRVDESIVLPSGTGQDTHI
254|gene|hut        MADQDIENAVTRALSESPERNFRETVDLAVNLRDIDLDDPSNRVDESIVLPAGTGQETTI
11415|gene|hma      MADQEIENAVSRALEDAPERNFRETVDLAVNLRDLDLNDPSNRVDESVVLPAGTGQETTI
1998|gene|hhi       MADQEIENAVSRALEDAPERNFRETVDLAVNLRDLDLNDPSNRVDESVVLPAGTGQETTI
                    ***  * :**: *:.::* ********:*:****:** **.:*:**.:***:****:* *

1105|gene|nrc1      VVFADGETAVRADDVADDVLDEDDLSDLADDTDAAKDLADETDFFVAEAPMMQDIAGALG
2535|gene|hla       VVFAEGETAVRAQEVADQVLDSDDLEDLGDDDDRAKDLADETDFFVAEANLMQDIGRYLG
2903|gene|hwa       VVFASGETALRAEDVADQVLSGDELEELGDDDDAAKDLADEIDFFVAEAGMMQDIGRFLG
12250|gene|hbo      VVFATGETALQAEEVADQVMDGDDLEDLGDDTDAAKDLADEIDFFVAEANMMQDIGRYLG
4452|gene|nph       VVFAEGETALRAEDVADDVLDSDDLEDLGDDDNAAKDLADETDFFIAEADLMQDIGRYLG
254|gene|hut        VVFADGETGIRAEEVADDVLDGDDLEDLGDDEDAAKDLAEETDFFVAEAALMQDIGRYLG
11415|gene|hma      VVFAEGETALRAEEVADDVLDEDELEELGGDDDAAKDLADDTDFFIAEKGLMQDIGRYLG
1998|gene|hhi       VVFAEGETALRAEEVADDVLDEDELEELGGDDDAAKDLADDTDFFIAEKGMMQDIGRYLG
                    **** ***.:.*::***:*:. *:*.:*..* : *****:: ***:**  :****.  **

1105|gene|nrc1      QVLGPRGKMPTPLQPDDDVVDTVNRMKNTVQIRSRDRRTFHTRVGAEDMSAEDIASNIDV
2535|gene|hla       TVLGPRGKMPTPLQPDDDIVDTVNRMKNTVQLRSRDRRTFHTRVGAEDMGPDAISDNIDV
2903|gene|hwa       TILGPRGKMPTPLQPDDDVVETVNRMQNTVQIRSRERRTFHTRVGAQDMDSEEIADNVDV
12250|gene|hbo      TVLGPRGKMPTPLQPDDDVVEVVNRMKNTVQLRSRDRRTFHTRVGAEDMSADEIAENIDV
4452|gene|nph       TVLGPRGKMPTPLQPDDDVVETVNRMKNTVQVRSGERRTFHTRVGAEDMDADAIADNVDV
254|gene|hut        TILGPRGKMPEPLQPDDDVVEVVERMKNTVQVRSGDRRTFHTRVGAEDMPSEEIADNVDV
11415|gene|hma      TVLGPRGKMPEPLDPDDDVVEVIERMKNTVQLRSGERRTFHTRVGAEDMSAENIADNIDV
1998|gene|hhi       TVLGPRGKMPEPLDPDDDVVEVIERMKNTVQLRSGERRTFHTRVGAEDMSAEDISDNIDV
                     :******** **:****:*:.::**:****:** :**********:** .: *:.*:**

1105|gene|nrc1      IMRRLHANLEKGPLNVDSVYVKTTMGPAVEVA-
2535|gene|hla       IIRRLEASLEKGPLNIDGIYVKTTMGPAKEVPV
2903|gene|hwa       IIRRLEATLEKGPLNIDSMYVKTTMGPAVEVPA
12250|gene|hbo      IVRRLEATLEKGPLNIDGIFVKTTMGPSVEVRA
4452|gene|nph       ILRRLFTDLEKGPQNIDTVYVKTTMGPAVEVPA
254|gene|hut        ILRRLHADLEKGPLNLDSVYVKTTMGPAVEVA-
11415|gene|hma      ILRRLHADLEKGPLNIDTVYVKTTMGPAMEVA-
1998|gene|hhi       ILRRLHADLEKGPLNIDTVYVKTTMGPAMEVA-
                    *:*** : ***** *:* ::*******: **