HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0483COG1885arCOG02119Uncharacterized protein conserved in archaeahypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0483 nrc1 VNG1264 vng1264 no entry
cHOG0483 hmu HMUK2408 Hmuk_2408 Protein of unknown function DUF555
cHOG0483 hma RRNAC1165 hypothetical protein
cHOG0483 hwa HQ2576A hypothetical protein
cHOG0483 hla HLAC1516 Hlac_1516 Protein of unknown function DUF555
cHOG0483 hbo HBOR15340 Hbor_15340 uncharacterized conserved protein
cHOG0483 hut HUTA0822 Huta_0822 Protein of unknown function DUF555
cHOG0483 hvo HVO_1680 HVO_1680 Protein of unknown function (DUF555) family
cHOG0483 nph NP4318A hypothetical protein
cHOG0483 hhi 1768 HAH_1768 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


1516|gene|hla      MPVGVVLGLMMDCRVVVEAAVPVYDVETADEAIRIAISKTGEMLNPDLNYVEIETGNRTS
2576|hp|hwa        ----------MDCSVAVEAAVPVYDVESTDEAVRIAISKTGEMLNPDLSYVEISMGSRHS
15340|hp|hbo       ----------MDCRVVVEAAVPVYDVETADEAIRIAIAKTGELLNPDLNYVEINMGSRTS
4318|hp|nph        ----------MNCRVVVEAAVPVYDVETTDEAVRIAISKTGEMLNPDLNYVEIDMGSRSC
1264|chp|nrc1      ----------MDCRVVVEAAVPVYDVQSTDEAVRIAISKTGEMLNPDLNYVEIEMGSRSC
822|hp|hut         ----------MNCRVVVEAAVPVYDVETADEAVRIAISKTGEMLNPDLNYVEINMSGRHC
11165|hp|hma       ----------MNCRVVVEAAVPVYDVASADEAVRIAISKTGEMLNPDLNYVEINMGDRHC
1768|hp|hhi        ----------MNCRVVVEAAVPVYDVASADEAVRIAISKTGEMLNPDLNYVEINMGDRHC
                             *:* *.********** ::***:****:****:*****.****. ..* .

1516|gene|hla      P-GGEELLPAFVAADEALVALQLRMDVFNVDREEHASRVARKEIGQRLRNIPLEVLRVEE
2576|hp|hwa        P-SGEELPPAFVAADEALVALELEMTVFNVERTEHASRIARKEIGQRLENIPLKILRIDP
15340|hp|hbo       P-SGEELLPAFVAADEALVALELEMTVFNVEQEEHAARIARKEIGQRLENVPLTVLEVEV
4318|hp|nph        AECGADQDPAFIAADEGLVALELEMTVFNVEREEHASRIARKEIGQRLENIPLEVIEVET
1264|chp|nrc1      PHCGTDTEPAFVAADESLVALELSMTVFNVERDEHAARIARKEIGQRLANIPLAVLEVDT
822|hp|hut         PHCGEELDPAFIAADESLVALELEMTVFNVERDEHAARIARKEIGQRLENIPLEIVEIEE
11165|hp|hma       PHCGETLEPAFLAADESLVALELEMTVFNVERDEHAARIARKEIGQRLENIPLDVLEIEE
1768|hp|hhi        PHCGETLEPAFLAADESLVALELEMTVFNVERDEHAARIARKEIGQRLENIPLDVLEIEE
                   .  *    ***:****.****:* * ****:. ***:*:********* *:** :: :: 

1516|gene|hla      IEGDSAKQSSTDSAEDGDSAHRDAIDSD-------------------GDSDE--------
2576|hp|hwa        IADDDEESPETNSETGSNISSGDESTNNTDDD---------------SDGDNLIPEFDEL
15340|hp|hbo       LPSEEEEEEQSA-----------------------------------ESDDDLIPEFDDL
4318|hp|nph        VEEEDLDETAADDEAAVEDDADEPPAADDGATAGADGEDRTDGGRRTDDDDEVLPEFEEL
1264|chp|nrc1      VTDDDTQESTGGDTETA-------------------------------------------
822|hp|hut         MEDEDDKTTEDDSDGSEMIDSTEAESTAASERAERSETDADDD----DRDDDVLPEFEEL
11165|hp|hma       IPEESDETTEDESSSAESEADADDPPSDQSA----------------DESDDVLPEFEEL
1768|hp|hhi        IPEEADETTDDESSSTESTAEADDQSSGQSE----------------DESDDVLPEFEEL
                   :  :  .                                                     

1516|gene|hla      ----
2576|hp|hwa        VEES
15340|hp|hbo       VDEG
4318|hp|nph        IDE-
1264|chp|nrc1      ----
822|hp|hut         IDE-
11165|hp|hma       IDE-
1768|hp|hhi        IDE-