HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0482COG3608arCOG02890Predicted deacylasesuccinate dehydrogenase subunit homolog (predicted deacylase)

HOG Organism Gene ID Name Annotation
cHOG0482 nrc1 VNG2106 sdh succinate dehydrogenase subunit homolog (predicted deacylase)
cHOG0482 hmu HMUK0840 Hmuk_0840 Succinylglutamate desuccinylase/aspartoacylase
cHOG0482 hma RRNAC2514 hypothetical protein
cHOG0482 hwa HQ1352A hypothetical protein
cHOG0482 hla HLAC0298 Hlac_298 Succinylglutamate desuccinylase/aspartoacylase
cHOG0482 hbo HBOR26910 Hbor_26910 predicted deacylase
cHOG0482 hut HUTA1255 Huta_1255 Succinylglutamate desuccinylase/aspartoacylase
cHOG0482 hvo HVO_0469 HVO_0469 sdh succinate dehydrogenase subunit
cHOG0482 nph NP1316A hypothetical protein
cHOG0482 hhi 2944 HAH_2944 succinylglutamate desuccinylase/aspartoacylase
MUSCLE (3.6) multiple sequence alignment


2106|gene|nrc1      MTSLGTASAAPGEFDSGRLTVGETRDGTTLGLPVAVVNGARDGKTLYMQAASDGDELNGV
298|gene|hla        MITLGTARAPPGETDTGRLEVGETRDGSPVRLPVAVINGAEDGETLYLQAVSDGDELNGL
12514|hp|hma        MVTFGTATAAPGEKDTGRLEVGETRDGSTFGLPVAVVNGIDDGRTLYIQAASDGDELNGV
2944|gene|hhi       MVTFGTATAAPGEKDTGRLEVGETRDGSTFGLPVAVVNGVDDGRTLYIQAASDGDELNGV
1352|hp|hwa         MTTLGTASAAPGEIDTGRLEIGETRDGTTVGLPCAVVEGASDGQTLYVQAASDGDELNGI
26910|hp|hbo        MISLGSASAAPGEVDTGRLEVGETRDGTTVGLPCAVVNGASDGKTLYLQAASDGDELNGV
1316|hp|nph         MTTLGTASAAPGEIDTGRLPVGEARDGSEVGLPVAVINGQADGKTLYMQAVSDGDELNGL
1255|gene|hut       MTSLGTASADPGEVATGRLYVGETRDGSDVGLPVAVVNGTEDGKTLYLQAASDGDELNGV
                    * ::*:* * ***  :*** :**:***: . ** **::*  ** ***:**.********:

2106|gene|nrc1      GVVRRVVPQLDPAEIAGEILIVGIANLPAFRVAEHRNPIDDTKLNRAYPGTADGSSSERI
298|gene|hla        GVVNRVVPRLDPAELSGTVLVVGVVNYFAFQVAEHRNPIDDRKMNRGYPGNEGGTTSERI
12514|hp|hma        GVIQRTLPQLDPMELSGTILVCGVVNYHAFQVAEHRNPVDDTKMNRAYPGDKTGTSSERI
2944|gene|hhi       GVIQRTLPQLDPAELSGTILVCGVVNYHAFQVAEHRNPIDDTKMNRAYPGDKTGTSSERI
1352|hp|hwa         GVLNRVIPQVDPAVLSGTVLAVGIVNYHGFQIAEHRNPIDDTKMNRAYPGNESGTSSERI
26910|hp|hbo        GVIQRLFPQLDPTELSGQILIVGIVNYHAFQVAQHRNPIDDTKMNRAYPGDENGTSSERI
1316|hp|nph         GVIRRLVPQLDPTKIAGELLIVGITNYYAFQVAEHRNPIDDTKLNRAYPGSKTGTASERI
1255|gene|hut       GVIQRLVPRLDPTEISGTILIVGIVNYHAFQVAEHRNPIDDTKMNRAYPGEETGTTSERI
                    **:.* .*.:**  ::* :*  *:.*  .*.:*:****:** *:**.***   *::****

2106|gene|nrc1      AHATFTAAESADLVVDLHQGSTSRMINEVRVRCGRHHRLHSQCLELAKVFGTGHVLDQKG
298|gene|hla        AHATFQAAKQADLILDLHQGSTSRMINETRVRCGVRHHLHGDCLELAKAFGCGHVLDIKG
12514|hp|hma        AAATFNAAISADYVLDLHQGSTSQMIDEVRVRCGTRHRLHEECLELAKVFGCGYILDQKG
2944|gene|hhi       AAATFNAAISADYVLDLHQGSTSRMIDEVRVRCGTRHRLHEECLELAKVFGCGYILDQKG
1352|hp|hwa         AAVTFAAAKRADLILDLHQGSTSQMIDEVRVRCGRRHRLHDECLGLAKTFGCGYVFDQKG
26910|hp|hbo        AAATFDAARRADLILDLHQGSTSQMIDEVRVRCGRHHRLHSECLQLAKTFGCGYVLDQKG
1316|hp|nph         AAATFDAAKQADLVLDLHQGSTSCMINETRVRCGTRHRLHRDCLELAKVFGCGHILDQKG
1255|gene|hut       AAATFEAATRADLVVDLHQGSTSRMIDETRVRCGTRHRLHDECLELAKAFDCGTVLDKKG
                    * .** **  ** ::******** **:*.***** .*.** :** ***.*. * ::* **

2106|gene|nrc1      PDGQLARAGPNTGVPTIDPELGGCVGWDADSIEYGVTGVFNVLRHYGFLDGDVDTTEQVR
298|gene|hla        PDGQLARAGPEHGIPTVDPELGGCVGWDEESIRYGVEGVFNVLRHYGFLDGDIELERQVR
12514|hp|hma        PDGQLARAAPDEGVPTIDPELGGCVGWDEDSIQRGVDGVFNVLHHYGFLDGHYDTRPQTR
2944|gene|hhi       PDGQLARAAPDEGVPTIDPELGGCVGWDEQSIQRGVDGVFNVLHYYGFLDGHHDTRPQTR
1352|hp|hwa         PNGQLARVAPDEGIPTVDPELGGCIGWDGESIDIGVRGVFNVLREYGFLEGTVSKSRQTR
26910|hp|hbo        PDGQLARAAPDEGIPTVDPELGGCVGWDEESIQKGVRGVYNVLRGYGFIDGSVETERQTR
1316|hp|nph         PDGQLARAAPDEGVPTIDPELGGAVGWDETSIRKGVKGVFNVLYYYGFLDGNVDPEPQTR
1255|gene|hut       PDGQLARAAPDDGVPTIDPELGGAVGFDQESIKIGVTGVRNVLRHYNFLDGEAPMEPQTR
                    *:*****..*: *:**:******.:*:*  **  ** ** ***  *.*::*      *.*

2106|gene|nrc1      AREFDRYGSPAGGLVDYAVELGDRVDAGDALFDVTDPFGMLKATVTADRNGIFWRSRRKP
298|gene|hla        ARGFDQYGSPAGGLVRFERELGERVSTGDLLYEVTDVFGELKARVTADDDGVFWRTRRLP
12514|hp|hma        ATGFEQYGSPVGGLIDFKPDLGDRVARGETLFEVTDVFGDPKAEITADSSGVFWRARRLP
2944|gene|hhi       ASGFEQYGSPVGGLIDLKPDLGDRVARGETLFEVTDVFGDPKAEITADSSGVFWRARRLP
1352|hp|hwa         ARGFDQYGSPAGGLIQFEAELGERIKTGDVLFEVTDIFGELKARITADNDGVFWRSRRLP
26910|hp|hbo        AKGFDQYGAPTGGLVRFKKSLGEQVSAGDVVFEITDVFGGLKARVTADNTGIFWRSRRLP
1316|hp|nph         ATGFEQYGSPAGGLVDFEFDLGDSVRRGDTLFKITDPFGTVKERVTADSEGIFWRHRRLP
1255|gene|hut       ASSFDQYGAPAGGLVDFEPDLGDRVDTGETLFTVTDVFGTVKERVTADSTGIFWRTRRLP
                    *  *:.**:*.***:    .**: :  *: :: :** **  *  :***  *:*** ** *

2106|gene|nrc1      QVATGEYVCSVGARVDTY
298|gene|hla        QVAAGEYVCSVGTNVDKY
12514|hp|hma        QVATGEYVCSVGTNIDTY
2944|gene|hhi       QVATGEYVCSVGTNVDTY
1352|hp|hwa         QVATGEYVCSVGTSVDSY
26910|hp|hbo        QVATGEYVCSVGTGIDTF
1316|hp|nph         QVATGEYVCSLGTNLDEY
1255|gene|hut       QVATGEYVCSVGTDIDSY
                    ***:******:*: :* :