HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0048arCOG02827hypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0048 nrc1 VNG0359 vng359 no entry
cHOG0048 hmu HMUK3188 Hmuk_3188 conserved hypothetical protein
cHOG0048 hmu HMUK1013 Hmuk_1013 conserved hypothetical protein
cHOG0048 hma RRNAC0219 hypothetical protein
cHOG0048 hma RRNAC2849 hypothetical protein
cHOG0048 hwa HQ1222A hypothetical protein
cHOG0048 hla HLAC0315 Hlac_315 hypothetical protein
cHOG0048 hbo HBOR24750 Hbor_24750 hypothetical protein
cHOG0048 hut HUTA0232 Huta_0232 conserved hypothetical protein
cHOG0048 hut HUTA1649 Huta_1649 conserved hypothetical protein
cHOG0048 hvo HVO_0739 HVO_0739 conserved hypothetical protein
cHOG0048 nph NP0850A hypothetical protein
cHOG0048 hhi 966 HAH_0966 hypothetical protein
cHOG0048 hhi 126 HAH_0126 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


1649|chp|hut      MPSLGEAYDDARWGDRRPRQIHAGIAVFLAGALAVVVAITLVTTPLSDALGLDT-VATYR
12849|hp|hma      MENLGDAYSNRRWEGRDPRRVVAGATLGGVGALAVVVAILLVTTPLSAVVGATEPHAAEK
126|hp|hhi        MENLGDAYNDRRWEGRDPRRVVAGATLGFVGALAVVVAILLVTTPLSAVVGATAPHAAEK
850|hp|nph        MASLTEVYE--GGSGAGLRRLYAGVVLFGVGVVLVTTGILIASTGLGAYVGLGL-YEARE
1222|hp|hwa       MTSLAETYN-STKGGPSLRRLTFGLTLFLMGSMLVVSGIGVTTTQLLYATDPAALTAKRQ
359|chp|nrc1      MTSLGEAYD-SRGGEASTRRVYLGMGLFAAGALLVAGGILAGATELLLSRGFGT-YESRE
315|hp|hla        MTSLSEAYGGRGRSEVDPRRVYLGVGSFVAGTLLLVVGLFVAAEVVLPS-GYSS-GEARR
24750|hp|hbo      MTSLSEAYHKGERAGPGLQRLLLGLGMFLLGVLLVVAGIVVATTSVLRGDGMSL-GDVRE
739|hp|hvo        MTSLSEAYH-GGRGGPSLRRLSLGFGGFLLGVLLVVAGIVVATTDVYTSGGATL-GEARE
10219|hp|hma      MTSLTDVYEGEVGRVASRRQQLVGTALFLVGVAGLVGAIALATTALGNRYGLDA-YAARR
966|hp|hhi        MTSLTDVYEGEVGRVASRRQQLVGTALFLVGVAGLVGAIALATTGIGNRYGLDA-YAARR
232|chp|hut       MTSLTDVYQRRMGAVASRRRVLAGLSLFAIGLGLVAVGVVLATTGIGATLGFGV-YGARE
                  * .* :.*          ..   *      *   :. .:   :  :    .         

1649|chp|hut      VSGVIAGVGVPGTFLGVVAVLP-SSRRQRLGVAIGTAVAAGGVALFWYAYPAHWT-----
12849|hp|hma      LGGTLGGLGIPAMFLSVVAVLP-SSRREQSGVAVGAVLCLVGIGLFQAAYPYNWT-----
126|hp|hhi        LGGTLGGLGIPAMFLSVVAVLP-SSRREQSGVTVGAFLCLVGVGLFQVAYPYNWT-----
850|hp|nph        VAGILGGVGLPAVLLGMLVALPRAARELQVGVGAGAVLCLIGVGMFRRWYPVDWVGA---
1222|hp|hwa       LGGVLAGVGVPAVLVGVFAILP-SARLTKAAAAVGTGISLMGVLLFDHAYPCQWSGAVCG
359|chp|nrc1      IAGVLGGLGIPAVFVGIFTVLP-ANRLQRAAAALGSGLTVLGVMLFRIAYPYKWYDA---
315|hp|hla        LGGVLGGVGVPLVFLGVMTVLP-ADRNTRVAAIVGAAVMCLGVALFAYAYPNQWVGGP-H
24750|hp|hbo      LGGILAGVGVPLVFLGIFTVTP-SGRLTKAAAIVGAGIALAGVALFWHAYPCQWSGSLCR
739|hp|hvo        LGGILGGIGVPAVFLGVLAVLP-ASRRTRAASLIGASIAVLGVALFSHAYPCQWTGATCG
10219|hp|hma      VAGIIAGLGLPSVILGVFAVLP-ASRRIRLTALGGTGVAAGGVGLFQSLYPYSWT-----
966|hp|hhi        IAGVIAGLGLPSVILGVFAVLP-ASRRIRLTALGGTGVATVGVVLFRSLYPYSWT-----
232|chp|hut       LAGILAGVGLPATFVGLFVVLP-TSRLTRATIAIGASLTVFAVALFTHAYPMQWPGAP--
                  :.* :.*:*:*  ::.:..  * : *  .     *: :   .: :*   **  *      

1649|chp|hut      ATQHSLAFHTAAVYFFGGALALWFVFATLANSHVRNDPHGTVRLRLTRQGESRVVEVSRD
12849|hp|hma      VGEQTLAFETTMAYFIGTCVAFWFVFTAMASFRRRNDPHGTVKLEISHKGETKTVEVSPK
126|hp|hhi        VGGQTLAFETTMAYFIGTCVAFWFVFTAMASFRRRNNPHGTVKLEISHKGETKTVQVSPK
850|hp|nph        SGNTTMTLVVAATYFAGAIVMTWSLFTAVANFKARNDPGGTVKLEVTKGGETKVVEVSND
1222|hp|hwa       AGKPDLTLLTVAVFSFGTMVTFWCLFIGVTNLRATDAESDPFESSQNASAGNQSDATS--
359|chp|nrc1      GAASTETLAFIVVYAAGIITTFWCLFTAVATFKTRNDPGGTVTMTVEQNGETRTVEVPTT
315|hp|hla        PELRDLTLPTAGLYFVGAATTLWSVFVGVANFKTRNDPGGTVTMEVTHKGETKVVEVDRA
24750|hp|hbo      RGRPDLTLLTVSVYFLGTLTTFWCLFVGVANFKTRNAPGGTATVEVTKKGETRYVEVERD
739|hp|hvo        AGLPDLTLETVAVYFFGTVTTFWCLFVGVANFKTRNDPGGTATVQVTKKGETRVVEVE--
10219|hp|hma      SSDPLLALLTGVVYFAGIVTTFWCLFASLATFKTRNDPGGTARMEVTEEGTIRLVEEART
966|hp|hhi        SSDPLLALLTGVVYFAGIVTTFWCLFASLATFKTRNDPGGTARMEVTEEGTIRLVEEART
232|chp|hut       AANPALALTTLALYFVGAITTGWCLFVAIATFKTRKSPGGAAEMRITEEGTVRLVEQAGT
                        ::     :  *     * :*  ::. .  .   ..        .  .       

1649|chp|hut      ------------------------------------------------------------
12849|hp|hma      ------------------------------------------------------------
126|hp|hhi        ------------------------------------------------------------
850|hp|nph        DL--------RGTLGGIGLLGGQPEGDVETQTNDGSRDRNRNKQATGGGAGVGSRSSDTR
1222|hp|hwa       --------------GAFGLFTTSRDETNTTPTS------------DGG--------TEAE
359|chp|nrc1      DVETAREALDAEGFGGVGVFGGVEDPAQETRAN---------------------------
315|hp|hla        QL--------NRG-GGVGLLGGTPDGDVETQTNRQEGSGSG---SGSG--------SASK
24750|hp|hbo      RS--------RGGLGGIGFLGGTPDGDTETQTARQSQTGQSGTVSDGG--------TDAA
739|hp|hvo        KS--------GGGLGGIGFLGGTPDGDVQTQTNQSTSTASAGA-TDGG--------ASTQ
10219|hp|hma      -L--------P-GLGGIGFFGQDPDGTVETQTN-RPGTGTEGAVSDGG--------TGQR
966|hp|hhi        -L--------P-GLGGIGFFGQDPDGTVETQTN-RASATDEGAVSDGG--------TGQR
232|chp|hut       NM--------P-AVGGVGMFGTDPDGDVPTQT----------------------------
                                                                              

1649|chp|hut      ------------------------------------------------------------
12849|hp|hma      ------------------------------------------------------------
126|hp|hhi        ------------------------------------------------------------
850|hp|nph        RRTESGSLSPRSSGGSGSPSRSSSRGSSSRSRQSRSAPGPAADA----------------
1222|hp|hwa       SITSPFDPTAASESSESPRSTQTNASPHSNPREQRSEPSPVQSK----------------
359|chp|nrc1      -------------------ASEPKPSAQSTPRSQPSPPGGASVS----------------
315|hp|hla        SRSPGSAQPAGMSDG-GATATGIRSPLDEDGGVDVETGGSDDQT----------------
24750|hp|hbo      SIT--------SPQGTG---TQSQSR----SRSPQSPSGPQSQS----------------
739|hp|hvo        DITPLDVEPSASPSSDGADATQSAGS----AGAATNRSGVDTVQ----------------
10219|hp|hma      SNDTRRANSCRRQPTGDTQSDRSTRSNRQSGSGTATERQSGRQANTRSSTGQQTTASSGA
966|hp|hhi        SGTTRTANGRSRQPTGGTQSDRSTRSKRRSDSGTATEGQSDRQATPRSNIGQRNTTSHGT
232|chp|hut       -------------------------------GNASTESTSARQA----------------
                                                                              

1649|chp|hut      ------------------------------------------------------------
12849|hp|hma      ------------------------------------------------------------
126|hp|hhi        ------------------------------------------------------------
850|hp|nph        -------------------SATDGGATDEPSIQTPGDDAEFLDDGPETPSNDRYCGNCTH
1222|hp|hwa       -------------------RPSPTPRSSSARTHPENEKNTWRSADVDASLGDQYCGNCAH
359|chp|nrc1      ------------------DGGATETDISSPLDGSDSRDGP---------GPDEYCGNCTH
315|hp|hla        -------------------GPAEPNGPVTPGVSPAARDGP----------GDTYCGNCAQ
24750|hp|hbo      -------------------SSSPQSQSQSRGSRSQSERGS-----SDQTAGDTYCGNCAH
739|hp|hvo        -------------------STESARSPAGAADHPDADR-P-----ANATVGDRYCGNCTY
10219|hp|hma      DQTGPSENTLDPRIAEAGPEATPSADGGTATTGRDA----ITETAVHQGEPDTYCGNCRH
966|hp|hhi        EQTGPSENALDPRIAEAGPEGSTSTDGGTATAGHDA----ITETAVHQGEPDTYCGNCRH
232|chp|hut       -----------------------ASDGGSTTIGSAADDGEIIESMPVRGQPDRYCGNCEQ
                                                                              

1649|chp|hut      -DYQRYAAAISD-GGEDAQVIREIESKYDE----------
12849|hp|hma      -EYRRYTQAVRGDGGTTDEVIQELESRIED----------
126|hp|hhi        -EYKRYTQAVRGDGGTTDEVIQELESRIED----------
850|hp|nph        FRYARTDDGLVPYCGLHSEAMDDMDA-CDKWSPNTK----
1222|hp|hwa       FEYVKTDSGIEPYCAAHDELMDDMVP-CEEWASRTD----
359|chp|nrc1      FDYVDTEDGMQPYCGLYDERMDDMEA-CEWWEQNSD----
315|hp|hla        FDYARTEQGMQPYCDHHDELMDDMDA-CEEWTPR------
24750|hp|hbo      FDYVRTDDGIQPYCGYHEELMDDMDP-CDEWASKR-----
739|hp|hvo        FEYVRTSDGLKPYCAAHDEMMQDMEA-CDEWFPRRRE---
10219|hp|hma      FEYVMQDGDIEPYCSFHGEVMDDMEA-CSAWVRND-----
966|hp|hhi        FEYVMQDGDIEPYCSFHGEVMDDMEP-CSAWVRND-----
232|chp|hut       FNYVRVDDELEPHCSHHSRYLDDMDA-CDAWESNSGDQMG
                    *      :          : :: .  .