HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0477COG0151arCOG04415Phosphoribosylamine-glycine ligasephosphoribosylglycinamide synthetase

HOG Organism Gene ID Name Annotation
cHOG0477 nrc1 VNG1305 purD phosphoribosylglycinamide synthetase
cHOG0477 hmu HMUK2316 Hmuk_2316 phosphoribosylamine/glycine ligase( EC:6.3.4.13 )
cHOG0477 hma RRNAC1109 hypothetical protein
cHOG0477 hwa HQ2560A purD phosphoribosylamine--glycine ligase
cHOG0477 hla HLAC1295 Hlac_1295 phosphoribosylamine/glycine ligase
cHOG0477 hbo HBOR15560 Hbor_15560 phosphoribosylamine--glycine ligase( EC:6.3.4.13 )
cHOG0477 hut HUTA0506 Huta_0506 phosphoribosylamine/glycine ligase
cHOG0477 hvo HVO_1657 HVO_1657 purD phosphoribosylamine--glycine ligase
cHOG0477 nph NP3972A purD phosphoribosylamine--glycine ligase
cHOG0477 hhi 1716 purD2 phosphoribosylamine-glycine ligase
MUSCLE (3.6) multiple sequence alignment


11090|hp|hma        MDEAEPFTYDGGIVAPGETRNIRYTV-----SETYLGDAVRMP--------VTIVNGKRP
1305|gene|nrc1      --MTERVLLLGGG---GREHALADAL--ADDCTLYAAASTRNPGIDALADDLTILNPADP
2560|gene|hwa       MSNTESVLLIGGG---GREHAIAQALTVDSRCTLYACAGNRNPGITALTADFESIPATSV
3972|gene|nph       --MTETVLLVGGG---GREHAIARAVDDSEHGTLYACASNRNPGIDELAAGYRELDETDA
506|gene|hut        --MTETVLLVGGG---GREHAVARAL-ADSDCSLYAAAGNRNPGIASLADGFETLDTTNP
1716|gene|hhi       --MTETVLLVGGG---GREHAIARSL-ADSPGELYACAGNRNPGIVALADGFEALDTTNP
1295|gene|hla       --MTETVLLVGGG---GREHAIARAV--ADDCALYACASNRNPGIRRLADGFETIDETDA
15560|gene|hbo      --MTETALLVGGG---GREHAIARALTASPDCELYACASNRNPGIASLSAGFRQVSETAA
                       :*     **    *  . :  ::        *   . * *           :     

11090|hp|hma        -------------------GPTVFLTAAAHGDELNGIEVVR----------EVAHEWNHD
1305|gene|nrc1      AAVVDHATA--IDATLVVVGPEAPLAAGVV-DALSDAGIYAFGPTQADARIETDKQFQRE
2560|gene|hwa       DAIVEYATTDPVNADLAIIGPESALEAGVT-DALDAAGVYTFGPTAEAARIETDKAFQRQ
3972|gene|nph       EAVVDYAES--VDATLAAIGPESALNAGVA-DALDAAGVYAFGPREAEAKIETDKAFQRE
506|gene|hut        TAVRTYAEE--IDATLAVVGPESPLEAGVA-DALDDAGVYAFGPQQNEARIETDKGFQRR
1716|gene|hhi       TAVTTYAQE--VDATLAVIGPEAALAAGVA-DALDDAGVYTFGPQEAEARIETDKAFQRR
1295|gene|hla       EAVADYATA--VGADLAVIGPESALAAGVA-DALDEAGVYAFGPQAEEARLETDKAYQRE
15560|gene|hbo      DDIVAYATE--VGADVAVIGPESALEAGVA-DALDDAGVYTFGPQAEDARIETDKAFQRE
                                       **   * *..  * *.   :            *. : ::. 

11090|hp|hma        GLAGTLI--CLPVLNVPAFLAQERYLPIYDRDLNRSFPGDPESTSAKRMAHEIFRN----
1305|gene|nrc1      FMAANDVPGQADFETFDDSDAAADYVTGVDGHVAVKPAGLTGGKGVRVTGDQLSKPAAAD
2560|gene|hwa       FMQSKSIPGCPEFAVFEETAAACEYIDAAENDLAVKPAGLTGGKGVRVIGDQVTQSEAKS
3972|gene|nph       FMADENIPGCPDFATFEDPEAAADYIRDYDGDLAIKPRGLTGGKGVRVIGDQITAAEGVD
506|gene|hut        FMERNDIPGLPDFEEFTDSEAACAFIDEYDGDLVVKPAGLTGGKGVRVIGDQVTAAEAKE
1716|gene|hhi       FMREHDIPGCPDFETFEDMDAACEYIDEYDGDLAVKPAGLTGGKGVRVIGDQCTAAEAKE
1295|gene|hla       FMDEADIPGCPDYAVFDDIEAACDHIDAYDGDLAVKPAGLTGGKGVKVIGDQVTAEEAKT
15560|gene|hbo      FMAEEGIPGCPDFSVFEDTEAACEYIDEYDGDLAVKPAGLTGGKGVKVTGDQVTKAEAKE
                     :    :        .    *   .:   :  :  .  * . .....  . :        

11090|hp|hma        FLAPCD----------VGLDFHTSTRGRTNMLHVRADMDDPKVARVAN------------
1305|gene|nrc1      YIRTSDHDDWVIEERLDGVEITVQALVANGDIRTTPVVHDHGRAYEGDDGPNTGGMGSIA
2560|gene|hwa       YLRENEYEQIVLEERLVGEEFTVQAFVANGEVRTTPAIQDHKRAYEGDTGPNTGGMGSYS
3972|gene|nph       YVLESDYEEFVLEERLVGEEFTVQAFVADGDYRVSPAVQDHKRAYEGDEGPNTGGMGSYT
506|gene|hut        YIRESDHDRLVLEERLVGEEFTVQALVANGDVRVTPAVQDHKRAYEGDEGPNTGGMGSYS
1716|gene|hhi       YLRSSDYDRVVLEERLVGEEFTVQAFVANGQLRVTPAVQDHKRAYEGDEGPNTGGMGSYS
1295|gene|hla       YLRDSDYDRVVLEERLVGEEFTVQAFVANGDLRTTPAVQDHKRAYEGDEGPNTGGMGSYT
15560|gene|hbo      YLRESDYEEVVLEERLVGEEFTVQAFVANGDVRPTPAVQDHKRAYEGDEGPNTGGMGSYS
                    ::   :           * :: ..:    .  .  . : *   *  .:            

11090|hp|hma        ------AFSSN------------VIISSEGPSGSLRRE--LSDSGVPTITIE--------
1305|gene|nrc1      GPGRLVPFATDADYQAAVDTIRAVVDGLEDYRGVLYGQFMLTADGPKVVEFNARFGDPEA
2560|gene|hwa       DTTQALPFMNDEEYADAVEVLEATVSALPNYKGVLYGQFMLTSDGPRVIEFNARFGDPEA
3972|gene|nph       DATPELPFMDEADYEAAVDVIDAVVEAMPEYKGILYGQFMLTTDGPKVVEFNARFGDPEA
506|gene|hut        DATLELPFMDRADYLEAVDILEATVDALEGYKGVLYGQFMLTAEGVKVVEFNARFGDPEA
1716|gene|hhi       DSSLHLPFMDEDDYMDAVDVLRATVEALDGYKGVLYGQFMLTETGPRVVEFNARFGDPEA
1295|gene|hla       DTGLSLPFMAEGDYDDAVDVLEAVVDALPDYKGVLYGQFMLTAEGPKVVEFNARFGDPEA
15560|gene|hbo      DSVAELPFMTFEDYTEAVEVLEATVDALDDYKGVLYGQFMLTADGVKVIEFNARFGDPEA
                          .*               .: .     * *  :  *:  *  .: ::        

11090|hp|hma        MGEAHRFQRPLIDSALESVR--SVLAEFGLRDSDTV-RW--PGWRTVIDDSGEKTWIRA-
1305|gene|nrc1      MNTLTTMETPLLD-VLAAARDGEALPELAFSEPATVCTYAVPDGYPTDPTGGTTITIDD-
2560|gene|hwa       MNTLPILETSLLD-VMRAAQHNESLPPLSFSNQATVCKYAVPKGYPTDPQGGTRITVDE-
3972|gene|nph       MNTLPVLETDFVE-LLAAARDGEPLPELSFAEQATVCKYAVPDGYPTDPEAGARVEIDA-
506|gene|hut        MNTLPVMETDLLD-VLVAARDGEALPQLQFQSAATVCKYAVPDGYPADPEAGAKVQIDP-
1716|gene|hhi       MNTLPVLNTDFLD-VLTAARDDDPLPQLSFRPLATVCKYAVPDGYPTDPDAGAKVPIDDD
1295|gene|hla       MNTLPVLETPFID-VLTAARDGNDLPKLSFTGEATVCKYAVPEGYPTDPDAGAKIAVDE-
15560|gene|hbo      MNTLPVLETPFLD-VVTAGRDGESLPELEFAGKATVCKYAVPDGYPTDPDDGAQIEVDE-
                    *.    ::  :::  : : .  . *. : :    **  :  *   ..    *    :   

11090|hp|hma        -----------------DSGGLVDMHYDRGDLVYEDDVICTIANPFKTENTLMRAPFTGL
1305|gene|nrc1      -----------------ASTGDAELFYASVDAHDDGSLTTTTSRSFAVVGTGDSIPAAAT
2560|gene|hwa       -----------------ESVESARIYYASVDAREDG-LYTTTSRAFAVVGIADSIATAES
3972|gene|nph       -----------------ESAGEAELFYASVDAREDG-IYTTTSRSFAVVGIDDDISGAEQ
506|gene|hut        -----------------ESAGAATLFYASVDEREDG-IYTTTSRSFAVVGVADSITDAEA
1716|gene|hhi       VIAEVVNDHRKQSGDDPETAPEALLCYASVDDREDG-IYTTTSRSYAVVGLAETIGDAEA
1295|gene|hla       -----------------ESVGDALLYYASVDERDDG-LYTTTSRAFAVVGRGDSIAAAEA
15560|gene|hbo      -----------------ENVGDALLFYASVDARDDG-LYTTTSRSFAVVGVEDTIAEAEK
                                      .   . : *   *   :. :  * :..: . .       :  

11090|hp|hma        LVGILENPLVYPGNPLCHLVRLDDRTQRAIEWNRRADDDDW
1305|gene|nrc1      SVDAALADLP-DGVRVRRDIGSKTLLADRNARMRRLRDGQ-
2560|gene|hwa       QAETALSAAD-DGLRIRHDIGTQSLLQRRIDHMSVIREE--
3972|gene|nph       IVEAAFERTGEEGLRVRHDIGKPDLVQKRIDHMTELRGE--
506|gene|hut        ITTEALERAGTDGLRVRWDIGKADLVQSRIDHMAELRGE--
1716|gene|hhi       IAEEALQRAGTEGLRVRHDIGKADLVQQRIDHMDDIRGGAD
1295|gene|hla       EAEDALAAAG-DRVRIRHDIGTADLVERRIEHMAEIRK---
15560|gene|hbo      AAEAGLSAAG-EGLRIRHDIGKPDLVQRRIDHVNELRGE--
                     .             : . :           .