HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0476COG0438KOG2941 KOG0853 KOG1111 KOG1387arCOG01403GlycosyltransferaseLPS biosynthesis

HOG Organism Gene ID Name Annotation
cHOG0476 nrc1 VNG0410 rfbU2 LPS biosynthesis
cHOG0476 hmu HMUK3144 Hmuk_3144 glycosyl transferase group 1
cHOG0476 hma RRNAC0179 rfbU LPS biosynthesis protein
cHOG0476 hwa HQ1558A hexosyltransferase; glycosyltransferase
cHOG0476 hla HLAC0582 Hlac_582 glycosyl transferase group 1
cHOG0476 hbo HBOR23930 Hbor_23930 glycosyltransferase
cHOG0476 hut HUTA0603 Huta_0603 glycosyl transferase group 1
cHOG0476 hvo HVO_0824 HVO_0824 rfbU LPS biosynthesis protein
cHOG0476 nph NP1476A hexosyltransferase homolog 3
cHOG0476 hhi 929 rfbU LPS biosynthesis protein
MUSCLE (3.6) multiple sequence alignment


410|gene|nrc1       MRVAFVSETTTHHEHGDDLDRLALLADCLLDRGHDVHVCCAQWWDGQPDVFDYDGVTYHA
582|gene|hla        MRVAFVSLFAPGHGDTSARSRTRRIARGLAERGHDVVWLCARWWGGDHDAFEDEGIAYRS
1558|gene|hwa       MRVAFVSLYVDDQRTEGATRRIRRIAEGLAARGHDVTVCCSRWWQGSVSTFTQNDVAYIG
23930|gene|hbo      MRIAFVSMYTEQLRADGATRRMRRVSERLAASGHDVSVLCAQWWEGEVPEFEQNDVNYIR
1476|gene|nph       MQVAVVFRDPPPQSERTGAVRLRRLAAAIQSAGHEVTVYCQPWWETDQRRIEINGLVHEG
603|gene|hut        MRVAFVSMRTARHRDTDGNRRLERLAGSLADRGHDVTVFCAAWWDDPADRREVDGLTYRA
10179|gene|hma      MRVAVVAMETSQYRDTVGRTRLERVATELAAAGHDVTVFCSQWWPGFDNQRERDGITYRA
929|gene|hhi        MRVAVVAMETSQYRDTVGRTRLERVATELAAAGHDVTVFCSQWWPGFDNQRERDGVTYRA
                    *.:*.*              *   ::  :   **:*   *  **         :.: :  

410|gene|nrc1       VTPDRGQRWFAPKAAGMVRTLGPDVVHATSRTPGHVYGARWGALLAGAPLVVDWYDTPEA
582|gene|hla        VTAEPSPSAFAARLPLALRRVDPDVVHAVNTPPTPGIAATVAGTLSRTPVIVDWWR--DH
1558|gene|hwa       LTEAKTPRAFALKLPFVLRRIAPDIIHATNSPPSQVIAAATAGIMIRTPLVVDWWQ--VD
23930|gene|hbo      VTETPSAPKFASKVPFALRRVKPDVIHATNSPPTQVTGAKTAARFLRVPVVVDWWA--ER
1476|gene|nph       VAFEH-PALFYTRLPGVLARRGPDVVLTSASPPGGVVAAWLGGLFARAPVVCDWYG--DE
603|gene|hut        VTVSPARASFAARLPIVLARYRPDVIHARLYPLAGVFAASAGGTLARTPLVIDYYG--DE
10179|gene|hma      VTVSPTVPSFCVRLPVMLARYRPDVVHVHPTPASVALAAKTGATLSRAPLLTEWFG--DE
929|gene|hhi        VTVSPTVPSFCVRLPAMLARFRPDVVHVHPTPSSVALAAKTGATLSRAPLLTEWYG--DE
                    ::       *  . .  :    **:: .   .     .*  .. :  .*:: :::     

410|gene|nrc1       HGGLTGRAYGYAARKPAVVVTPSRTVKTAVREHGGRTDAIRVLPTGIDMDRIRHAVPGGG
582|gene|hla        -PADSRRRYRLLARRADAVTTPSRTTKTRVREYGAAGEDVRVLPESIDFDLVESAGVDDR
1558|gene|hwa       -ETDHPWVVRRAARAGSRHFTPSQLIKTDVRSVGGDTDSIIRLPESIDFELVRDADIYDR
23930|gene|hbo      -EGDSSSACKRAARGPKRVIAPSQMVKTDVREYGASEEAVRVVPESIDFELVREAEADDR
1476|gene|nph       PNAMSSRWAGKAASLPTRVVAPSELQRTRIRELGGTEANTTTIPLGISMSKIQAADPDEF
603|gene|hut        -GLSESRLLRQAFREATTVITPSELVRTRVREQGIPDQRTTVIPDAIDFSLVSETVPAEE
10179|gene|hma      -NVPENRRAGLALQASDCLITPSELVRTRVRERGATADQTAILPQSIDMDLVSEVDAGEE
929|gene|hhi        -DVPESRRANLALRASDCLVTPSELVRTRVRERGATADQTAILPQSIDMDLVREVDPDEE
                                        :**   .* :*. *        :* .*.:. :  .     

410|gene|nrc1       GDIVCSRRLDGDANVESLFLALAEFR-EYDWNCTIVGDGPARADYERQARDLRIADRVDF
582|gene|hla        FDAVYARRLDRHANVETFLLGLAELR-DRDWTAAVVGDGPERARIESTASDLRIDDRVSF
1558|gene|hwa       ADIVYARRLDDESNIDSFLLALAELR-NKQWRTAVIGDGPQRSDAEAMARDLRIDDRITF
23930|gene|hbo      ADILYSRHLDQYANVESFFLALAELR-DKDWRAAVIGDGPERAEAEQTAADLRIDDRVEF
1476|gene|nph       RDIVYAGHLDDDANLESLLLALAELRDDGDWTATVIGDGPRRDDYERQARDLRILDRIDF
603|gene|hut        TDVAFAHRLDDSANVESLLLALAELR-NRDWSATIIGDGPLRADYERQAADLRIDDRITF
10179|gene|hma      IDVVYAHRLDGSANVESLLLGLAELR-QKGWSATIIGDGPERAHYEQEAADLRIDDRVTF
929|gene|hhi        IDVVYAHRLDGSANVESLLLGLAELR-QKGWSATIIGDGPEREYYEQEAADLRIDDRVTF
                     *   : .**  :*:::::*.***:* :  *  :::**** *   *  * **** **: *

410|gene|nrc1       VGDCTVDERVEIFKNAHVYVHTAEKTPFAHDLLRALACGCVGIVEYHAESSAHELIETYP
582|gene|hla        LGDLPLRERVELFKGTHVAVATATWETFATDLLWALACGCVALVEYQADSSAHELVEGRQ
1558|gene|hwa       YGSMELEQFVSTLKGAHVFAQTASVEPFARELLWALACGCVGVVEYQARSSAHELLEDYE
23930|gene|hbo      LGELPPEEFVPIMKGAHVFAQTAAVEPFANDLLWALASGCVGIVEYQARSSAHELVVNCD
1476|gene|nph       RGNCDRAERIAVYRGAHTFVQTARRANFAEELLWALACGCVGVVEMQSDSSAHELVERRE
603|gene|hut        AGECSRAERLAIYRGAHTFVQTAYREHFARELLWALAAGCVGIVEYQAESSAHELIENHP
10179|gene|hma      AGACDTEERVSIYKGAHVFVQTAFRECFATDLLWAMACGCIGIVEYQAESSAHELIEQRD
929|gene|hhi        AGACDIEERVSIYKGAHVFVQTAFRECFATDLLWAMACGCIGIVEYQAESSAHELIEQRD
                     *     : :   ..:*. . **    ** :**.*:*.**:.:** :: ******:    

410|gene|nrc1       RGFRATSDEEITECLVQAGDLERKAVDESFAEHDHEQFLDTYLTAYADAQAATGLF-
582|gene|hla        RGRLVTSPAELADEFVAVGDLDRKAVERDFASYDHDAVLDRVVDAYRELLNGE----
1558|gene|hwa       RGARVTDPEGIAAEIESAAEINSSVIAESFSKYDHRAVLKQYEDQYVAAQSEFGWFS
23930|gene|hbo      RGARVTSPQELADEISAAAGYSQESINEEFASFDHDDVLRRYEDIYADAIEDYGWF-
1476|gene|nph       RGFRVTDMENLDEAIEAAWDCSYRDIDKAFQQFDHAAVAGKYLELFRDCGVESR---
603|gene|hut        RSFHVTDPQELADAIVSAGDIERRTIDDAFESYDNDAVLESYLDLYRRVQASHGLF-
10179|gene|hma      RAFRVTNPQEIADKITESAGFERRTVDESCAEFDHAQVRARYEDLYEKQIEDAGLF-
929|gene|hhi        RAFRVTNPQEIADKIAESADFERRTVDESCAEFDHAQVRAEYEDLYESRIEETGLF-
                    *.  .*.   :   :      .   :     ..*:  .       :