HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0474COG1488KOG2511arCOG01481Nicotinic acid phosphoribosyltransferasenicotinic acid phosphoribosyltransferase

HOG Organism Gene ID Name Annotation
cHOG0474 nrc1 VNG2541 cobB nicotinic acid phosphoribosyltransferase
cHOG0474 hmu HMUK0260 Hmuk_0260 Quinolinate phosphoribosyl transferase( EC:2.4.2.19,EC:2.4.2.11 )
cHOG0474 hma RRNAC2241 nicotinate phosphoribosyltransferase
cHOG0474 hwa HQ1058A pncB nicotinate phosphoribosyltransferase
cHOG0474 hla HLAC2471 Hlac_2471 Quinolinate phosphoribosyl transferase
cHOG0474 hbo HBOR04040 Hbor_04040 nicotinic acid phosphoribosyltransferase( EC:2.4.2.11,EC:2.4.2.19 )
cHOG0474 hbo HBOR39320b Hbor_39320 putative nicotinate phosphoribosyltransferase( EC:2.4.2.11 )
cHOG0474 hut HUTA0977 Huta_0977 Quinolinate phosphoribosyl transferase
cHOG0474 hvo HVO_1804 HVO_1804 nadC nicotinate phosphoribosyltransferase (TBD)
cHOG0474 nph NP1174A pncB nicotinate phosphoribosyltransferase
cHOG0474 hhi 2710 pncB nicotinate phosphoribosyltransferase
MUSCLE (3.6) multiple sequence alignment


39320|hp|hbo        ------MLAVGLEQAIHYIETLSFGERAIDYLTEHGFEEEFLSKLETLEFTG--------
1058|gene|hwa       MD----FDIIDTEAITSGTATDAYFERTETTLQHADRNPTITAEVTADQFPDGNFEMIAG
2541|chp|nrc1       VT----FDIVGADAIKRGRATDAYFDRTLEALEHADRNPHVVAEVTADQFPTGEFEVLAG
1174|gene|nph       M-----FDTVPGSAIESGRATDAYFLRTEEALEHAGRNPHVVAEVTADQFPTGEFELLAG
977|gene|hut        MTEETPFDIVGPEAITAGRATDAYFDRTMEALEHAGKNPNVVAEVSADQFPTGEFAVLAG
12241|gene|hma      MTEE--FDVVSPEAIREGRATDAYFDRTMEALEHAGKNPDVVAEVTANQFATGQWKLLAG
2710|gene|hhi       MTEE--FDVVSPEAIREGRATDAYFDRTMETLEHAGKNPDVVAEVTANQFATGQWKLLAG
2471|gene|hla       MTE---FDIVDAAAIRDGRATDAYFERTEAALEHAGRNPRVVAEVTADQFPDGDFELFAG
4040|gene|hbo       MD----FDIVGTDAIRDGSATDAYFERTETTLRHAEKNPHVVAEVTADQFPDGDYELLAG
                          :  :          * ::  *:   *     :  . ::: : :*.         

39320|hp|hbo        -------------DVRALPEGEPVFPNEPLLEVTAPILQGQLLETIAINQIGYQSLIATK
1058|gene|hwa       VKNAVALLEGRNVDVNSLLPGR-LFDGGPVFRIQGKYLDFARLETSILGFLSHASGVATA
2541|chp|nrc1       LQDAAELLADVPVDVHALPEGT-LFDGGPVMRITGPYQSFARYETALLGFLSHASGMATA
1174|gene|nph       LEDAARLLEGRDIDVDALPEGT-LFDGGPVMRIEGPYLEFARLETSLLGFLSHPTGMATA
977|gene|hut        LKDAAHLLEGHPVDVDALPEGQ-LFDHGPVMRIEGQYQEFARLETSLLGFLSHPTGIATN
12241|gene|hma      LKDAAKLLEGRSVDVDALPEGQ-LFDGGPVMRIEGAYREFCRLETALLGFLSHSTGIATR
2710|gene|hhi       LKDAAELLEGRSVDVDALPEGQ-LFDGGPVMRIEGPYREFCRLETALLGFLSHPTGIATR
2471|gene|hla       LKDAVALLEGRDIDVDAIPEGR-LFDGGPVMRIEGPYLTFARLETSLLGFLSHASGMATA
4040|gene|hbo       VKDAAALLEGHDVDVDAIPEGR-LFDGGPVMRIEGSYLDFGRFETSLLGFLSHASGVATA
                                 ** ::  *  :*   *:: : .        **  :. :.: : :** 

39320|hp|hbo        AARMRDTIERHGDDQSLVDFGSRRAHGSDAGMKAARAAYIGGFDGTSNVAAGEAFGIPIY
1058|gene|hwa       AANAR----KAAPSSTVLSFGARHVHPTIAAM-VERSALIAGVDGFSHMAAGDVLDRTAG
2541|chp|nrc1       ALAAR----RAAPDSHLLSFGARHVHPSIAAV-VERAALIGGFDGFSHVAAGDVLDREPG
1174|gene|nph       ALEAR----QAAPDTSLLSFGARHVHPSIAGT-VDRSALIAGFDGFSHVAAGDILDREAS
977|gene|hut        ALRAR----RAAPESTVLSFGSRHVHPSLGAM-VERSALIGGLDGISNVAAGEVIDREAG
12241|gene|hma      ALEAR----HAAPESTVLSFGSRHVHPSISAM-VERSALLGGLDGISNVAAGEVIDRDAG
2710|gene|hhi       ALEAR----YAAPESTVLSFGSRHVHPSIAAM-IERSALLGGLDGISNVAAGEVIDRDAG
2471|gene|hla       ALDCR----VAAPDSQVLSFGARHVHPSMTAA-VERSALVGGFDGFSHVAAGDLIGREAS
4040|gene|hbo       ALDVR----RAAPDSTVLSFGARHVHPALTAM-IERSALLAGLDGISHVAAGDVLGREAS
                    *   *      . .  ::.**:*..* :  .    *:* :.*.** *::***: :.    

39320|hp|hbo        GTMAHSWIQSF--ATERAAFEAFVDEYGED--SILLIDTYDTVAGAETARDVADKRDIDV
1058|gene|hwa       GTMPHALLICFGRGEQEQAWQAFDEAVPEAVPRIALCDTYSDEAD-EALRAARTLGD-RL
2541|chp|nrc1       GTMPHALVICFGRGNQEAAWRAFTDGVGDDVPRIALCDTYSDEKD-EVLRAVDELGD-DL
1174|gene|nph       GTMPHALMICFGPGNQEEAWQAFDEAVAPDVPRIALCDTYDDEVD-EAVRAAEL----GF
977|gene|hut        GTMPHALVICFGRGNQEAAWQAFDEAVGPGVPRVALCDTYSDEVD-EAIRAVEAV-P-DL
12241|gene|hma      GTMPHALMICFGRGNQEQAWQAFDAAVPEETPRVALTDTYSDETD-EALRAAEAV-D-DL
2710|gene|hhi       GTMPHALMICFGRGNQEQAWQAFDAAVPEETPRIALTDTYSDEVD-EALRAAEAV-D-DL
2471|gene|hla       GTMPHALSICFGRGEQEAAWRAFNEAVDEAVPRIALCDTYSDEVD-ETLRAVDALGD-RL
4040|gene|hbo       GTMPHALLICFGRGNQEEAWKAFDEAVEESVPRVALCDTYSDETD-EVLRAVEALGD-DL
                    ***.*:   .*  . :  *: **          : * ***.   . *. * .       .

39320|hp|hbo        AGVRLDS-----GNLTALSKEVNELLG-----DTDIFVSSGVDEFKIRDFLTSGGVGTGF
1058|gene|hwa       DGVRLDTTGSRRGDFQHIIREVQWTLDTHGYEDVDIFVSGGLNPNDLLNL---RDVADGF
2541|chp|nrc1       DAVRLDTTSSRRGDFRHIAREVQWALDAGGNSDVSVFVSGGLTPTDLRGL---RDVVDGF
1174|gene|nph       DSVRLDTTGSRRGDFRHIVRETRWKLDVAGHEDVDIFVSGGITPEAIRNL---KDVADGF
977|gene|hut        DSIRLDTTSSRRGDFRRIVQEVRWELDARGHDDVGIFLSGGLDPTTLREL---RDVADGF
12241|gene|hma      TGVRLDTTGSRRGDFRHIVREVRWTLDAYGHEDVDLFLSGGITPTTLREL---RDVADGF
2710|gene|hhi       AGVRLDTTGSRRGDFRHIVREVRWTLDAHGHEDVDLFLSGGLTPTTLREL---RDVADGF
2471|gene|hla       DGVRLDTTGSRRGDFRHIIREVQWELDVRGHDDVDVYVSGGLGPADLREL---RDVVDGF
4040|gene|hbo       DSVRLDTTSSRRGDFRHIVREVQWTLNAHDHESVDVFVSGGLGPSDLRHL---RDVADGF
                     .:***:     *::  : .*..  *.     ...:::*.*:    :  :    .*  **

39320|hp|hbo        GPGTALVTSTDAPKVEGVYKLVAIERDGEMRPSMKLSTGKATYPGAKSIYRVERDGSYAY
1058|gene|hwa       GIGGYISNADPVD-----FALDIVAVDDE--PVAK----RGKLAGIKSVYRTSEGGHHI-
2541|chp|nrc1       GVGGFVSNATPVD-----FGLDIVEVAGE--PAAK----RGKLSGTKAVYRTPDGGHHV-
1174|gene|nph       GVGSHITNADPVD-----FALDIVEVEGD--PAAK----RGKLSGTKAVYRTTDGGHHI-
977|gene|hut        GVGGYVSNAEPKD-----FALDIVSIDGE--PVAK----RGKLSGKKAVYRTDTGSHEV-
12241|gene|hma      GVGGYVANADPLD-----FALDIVQLDGE--PAAK----RGKLTGTKSVYRTADGGHHI-
2710|gene|hhi       GVGGYVANADPLD-----FALDIVELDGE--PAAK----RGKLTGTKSVYRTADGGHHI-
2471|gene|hla       GVGGYVSNADPVD-----FALDIVAVEGE--PAAK----RGKLSGAKDVYRTADGVHAV-
4040|gene|hbo       GVGGYVSNANPVD-----FALDIVEIDGE--PAAK----RGKLTGVKEVYRTADGGHHV-
                    * *  : .:         : *  :   .:  *  *    ... .* * :**.  .     

39320|hp|hbo        DTLTPQKEDHDGDELLVSVIEDGDIVYD--FPDLQTVQEFALRNVEKIPVEARTLENPTT
1058|gene|hwa       -GLHNQPSPDDSESLLNPVIRDGKVVDHIDF-GIDAAVERATQDRNRCKY--EINIE---
2541|chp|nrc1       -ALASQPAPADATALLEPLLVDGTVSMA--F-DIDDAAARARQDARAVSF-----RQ---
1174|gene|nph       -ALADADPPDDADPLLEPLIRDGDIVAD--V-ELSAAAERARADAERVGF-GEH------
977|gene|hut        -GLADEEGPGDAESLFEPLLRDGELVRE--F-DIDDATRRARKDAEAVGF-GDHADQ---
12241|gene|hma      -GLADRDGPADAESLLEPLIRDGEIVRE--F-DLNGAIDRAAADAERVGYEGVTVAE---
2710|gene|hhi       -GLADRDAPEDAESLLEPLIRDGDIVRE--F-DLDGAIDRAAADAERVDYEGATAAE---
2471|gene|hla       -GLADRSGPDGAESLMEPVIRDGEVVADDAF-DLAAATERALADAETVGY-GTNE-----
4040|gene|hbo       -GLEDADSPTDAEPLLEPLIRDGEIVRE--F-DLDAAAARARADAERCGY-GAE------
                      *       ..  *: .:: ** :     .  :  .   *  :                

39320|hp|hbo        YEVRISPELDTQTTELRQQLESQFT
1058|gene|hwa       -------------------------
2541|chp|nrc1       -------------------------
1174|gene|nph       -------------------------
977|gene|hut        -------------------------
12241|gene|hma      -------------------------
2710|gene|hhi       -------------------------
2471|gene|hla       -------------------------
4040|gene|hbo       -------------------------