HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0473COG0589arCOG02053hypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0473 nrc1 VNG2523 vng2523 no entry
cHOG0473 hmu HMUK0221 Hmuk_0221 UspA domain protein
cHOG0473 hma RRNAC2223 usp2 universal stress protein
cHOG0473 hwa HQ1063A usp homolog to stress response protein
cHOG0473 hla HLAC1910 Hlac_1910 UspA domain protein
cHOG0473 hbo HBOR03870 Hbor_03870 universal stress family protein
cHOG0473 hut HUTA0968 Huta_0968 UspA domain protein
cHOG0473 hvo HVO_1820 HVO_1820 universal stress protein family
cHOG0473 nph NP1710A homolog to stress response protein
cHOG0473 hhi 2695 HAH_2695 universal stress protein
MUSCLE (3.6) multiple sequence alignment


2523|hp|nrc1        MRDGDTHDMKVLVGIGGADDSLVALEESVRRAVDTGDSLTVGVVANPESNRDPSALVDAA
1063|gene|hwa       --------MKILLGVDGTDTSLHALEQTVKRAKEAGDDVTVGIV-TRDSDRSVAGTRSDV
1910|gene|hla       --------MKVLCGIGGSDDSFRALDRTVERAAVANDDLTVAVVDNEDSSVAPDDVMERA
1710|gene|nph       --------MKVLLGIGGSDDSLLALEKAVDRAREAGDELTIAIVENPDSDRSPESIRDRV
3870|gene|hbo       --------MKVLLGVGGSDDSIRAVKQTVARAAAAGDDLTVAVVENPASDRSREEITEIV
968|gene|hut        --------MKILLGVGGSERSRRALEDTVERVQETGDELAVAIFDAEDVDATTTEIESDV
12223|gene|hma      ---MHGPTMKILLGVGGSELSYQALTETLDRVAETGDELTVAVFDNEDNDADLEAVQQRI
2695|gene|hhi       --------MKILLGVGGSELSYQALTETLERVSETGDELTVAVFENGDIDADLETVQQRI
                            **:* *:.*:: *  *:  :: *.  :.*.:::.:.     .       .  

2523|hp|nrc1        TAALADAGLPTDVRELSGD-PGSALVEVAESEDFDQIVLGGGKRSPMGKIKLGHIAEFVL
1063|gene|hwa       DEIIESSEIDVTVQHLDGD-PGSQLVELAESEDFDKLVIGGGKRSPMGKIQIGSLAEFIL
1910|gene|hla       QEAVDDAGIDADVRRVGGD-PGSRLVEIAETEGFEEIVLGGGHTSPMGKITIGSIAEFVL
1710|gene|nph       KSVLDESGFDAEVRMVSGH-PGSQLLELAEREDFDRIALGGGETSPLGKVQLGSIAEFVL
3870|gene|hbo       REILDEEGVEAEVRHLEGD-PGSQLVDTAESENFDEIVLGGGETSPMGKINIGSIAEFVL
968|gene|hut        RDVLDSAGVDAEIHRLSGH-PAGDLVGLADEGDFDRLVIGGGQRSPLGKIQLGSIAEFVI
12223|gene|hma      QERIDESGLEPPIRRVEGTSPGSELVNIAESEGFDRIVLGGGGRSPLGKIQLGPIVEFVL
2695|gene|hhi       QEYIDESGLEPPIRHVEGTSPGSELVNIAESEEFDRIVLGGGGRSPLGKIQLGPIVEFVL
                       : .  .   :. : *  *.. *:  *:   *: :.:***  **:**: :* :.**::

2523|hp|nrc1        LNSRTSVKLVRDDAG
1063|gene|hwa       LNSRITVSLIR----
1910|gene|hla       LNAKTSVTLVR----
1710|gene|nph       LNARTTVTLIR----
3870|gene|hbo       LNSHVTVSLVR----
968|gene|hut        LNAETPVTLIR----
12223|gene|hma      LNAQTPVTLIR----
2695|gene|hhi       LNAQTPVTLIR----
                    **:  .*.*:*