HOG Organism Gene ID Name Annotation
aHOG4726 nph NP2566 hypothetical protein
aHOG4726 nph NP4716 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


2566|hp|nph      MPSATVACPYCETDNTVTVPDGVDIKKV--VKSYRTGIRGDKNVSEAECAGGHHF-----
4716|hp|nph      MGDQVVACPICDTHINFSVVELTADKEIKFVKDTEIEPSDDYDVHEAQCPSGHSFYYAAG
                 * . .**** *:*  ..:* : .  *::  **.      .* :* **:*..** *     

2566|hp|nph      GVKYRSK
4716|hp|nph      DVDPLAA
                 .*.  :