HOG COG KOG arCOG COG description NRC-1 annotation
tucHOG0472arCOG06240hypothetical protein

HOG Organism Gene ID Name Annotation
tucHOG0472 nrc1 VNG1479 vng1479 no entry
tucHOG0472 hmu HMUK2084 Hmuk_2084 conserved hypothetical protein
tucHOG0472 hma RRNAC0876 hypothetical protein
tucHOG0472 hwa HQ2714A peptidoglycan binding protein
tucHOG0472 hla HLAC2502 Hlac_2502 hypothetical protein
tucHOG0472 hbo HBOR11600 Hbor_11600 hypothetical protein
tucHOG0472 hut HUTA0189 Huta_0189 conserved hypothetical protein
tucHOG0472 hvo HVO_2705 HVO_2705 conserved hypothetical protein
tucHOG0472 nph NP4336A hypothetical protein
tucHOG0472 hhi 1514 HAH_1514 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


2502|hp|hla        ---------------------------------------------------------MQP
4336|hp|nph        --------------------------------------------------------MPTR
10876|hp|hma       ------------------------------------------------------------
1514|hp|hhi        ---------------------------------------------------------MPT
2714|gene|hwa      MSTGELKYRVSAFISILVLKISSLILTELGHSADLISGSHQHRLNRYYFEDCDEDSFVEP
11600|hp|hbo       ---------------------------------------------------------MPR
189|chp|hut        --------------------------------------------------------MAEP
1479|hp|nrc1       ------------------------------------------------------------
                                                                               

2502|hp|hla        VERAEYEGIDYAWVMQTTFVVTILVGAPVVAVLSVFVTLDSWPARAAFAVRVGAPIWFAT
4336|hp|nph        VETTDPDGVDYGWVMQTTFVLTIIVGAPVVAALSLLVELPTWGQRANFAIRVGAVVWLCL
10876|hp|hma       --------------MQVTFVTTILVGSPLVVLASTAVTLQTWTARALFAVRVGALIWFLT
1514|hp|hhi        VEKTDPDGVDFGWVMQVTFVTTILVGSPLVVLASTAVTLQTWTARAMFAVRVGALIWFLT
2714|gene|hwa      VETTDPDGVDYGWVMQTTFVLTIIIGAPVVTVLSLGATLPTWGTRVGFAIRVGAVIWILT
11600|hp|hbo       VERTNPDGVDYGWVMQTTFVVTILVGSPTVAALSIAYELPTWAARASFAIRVGAVIWILT
189|chp|hut        SARTDPDGVDHGWVLQTTFVVTIVLGAPIVAVLSLGQSLPTWTARATFAIRVGAVVWFLT
1479|hp|nrc1       --------------MQTTFVVTIVVGAPIVTALSTGYSLPTWASRVSFAVRIGAIIWFLT
                                 :*.*** **::*:* *.  *    * :*  *. **:*:** :*:  

2502|hp|hla        AVAVAVYARRTDAGDGGVA-----------------------------------------
4336|hp|nph        GIGVFFYARRDAG----AG-----------------------------------------
10876|hp|hma       AVCVYLYARYRA------------------------------------------------
1514|hp|hhi        AVCVYLYARYRA------------------------------------------------
2714|gene|hwa      ALSVFGYARWSDTNTDTNGVDTESVNTPSASSEKSTSDVSSRTHVDSHTNTNTNTNTNTN
11600|hp|hbo       AISAFIYAKRTDAGDGGTP-----------------------------------------
189|chp|hut        AVGVFVYERRYRA-----------------------------------------------
1479|hp|nrc1       AVTVFAYARRHAA-----------------------------------------------
                   .: .  * .                                                   

2502|hp|hla        -------------EADDDPDAADDPGGAEKVDEDAGDA-------------------
4336|hp|nph        -------------QADSDGESGDETR-------------------------------
10876|hp|hma       ---------------------------------------------------------
1514|hp|hhi        ---------------------------------------------------------
2714|gene|hwa      TNTNTNTNTNSNSDADMDPDPNPDPSIDIDSHSNTETGTSQTTQQNSDTTTAAEETS
11600|hp|hbo       ------------PEADIEMDD------------------------------------
189|chp|hut        ---------------------------------------------------------
1479|hp|nrc1       ---------------------------------------------------------