HOG COG KOG arCOG COG description NRC-1 annotation
tucHOG0470arCOG04718hypothetical protein

HOG Organism Gene ID Name Annotation
tucHOG0470 nrc1 VNG2044 vng2044 no entry
tucHOG0470 hmu HMUK1175 Hmuk_1175 conserved hypothetical protein
tucHOG0470 hma RRNAC2492 hypothetical protein
tucHOG0470 hwa HQ1342A hypothetical protein
tucHOG0470 hla HLAC2391 Hlac_2391 hypothetical protein
tucHOG0470 hbo HBOR04990 Hbor_04990 hypothetical protein
tucHOG0470 hut HUTA1509 Huta_1509 conserved hypothetical protein
tucHOG0470 hvo HVO_1894 HVO_1894 conserved hypothetical protein
tucHOG0470 nph NP5046A hypothetical protein
tucHOG0470 hhi 2923 HAH_2923 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


1342|hp|hwa       -----MDEETKQGDIFGVPYNFERPSLGRLIAARWQPDAGMIVKKPFGIGYTLNLANWRS
4990|hp|hbo       MYLPVMADKPQKGEILGVPYNFERPSLGRMLSSYWKPGEKMLVKKPFGIGYTLNLANWRS
12492|hp|hma      -----MAEKPQSGTLFGVPYNFERPSLKRLVSSYWKPGDDMLVEKPFGIGYTLNLANWRS
2923|hp|hhi       -----MAEKPQSGTLFGVPYNFERPSLKRLVSAYWKPGDDMLVEKPFGIGYTLNLANWRS
2044|hp|nrc1      -----MVEKPTSGSLFGVPYNFERPKLSAMLSAYWQPGEGMLVEKPFGIGYTLNLANWRS
2391|hp|hla       -----MADKPSSGEILGIPYNFERPSLGRLLSSYWQPGKGMLVEKPFGIGYTLNLANWRS
1509|chp|hut      -----MSEKPQTGEIFGIPYNFERPSMKRLLSAYWQPGEGMLTKKPFGVGYTLNLANWRS
5046|hp|nph       -----MTDKPQSGELFGIPYNFERPSISRMLSAYWQPGEGMLVKKPFGIGYTLNLANWRS
                       * ::.  * ::*:*******.:  :::: *:*.  *:.:****:***********

1342|hp|hwa       WVALLVVGLLLFQEER-----GNSESEDDS-------PVEVIVD--
4990|hp|hbo       WVVVLVAGALLWQERS-----SSSTDLEDEDEDEG--PVEVIVD--
12492|hp|hma      WVVLAVAGVMLYLERG-----GSSEEFESENEDE---PVEVVVD--
2923|hp|hhi       WVVLAVAGVMLYLERG-----GSSEEFESESEDE---PVEVVVD--
2044|hp|nrc1      WIVLGVAGVLLWQQQGSD---AASEDAESAVDD----AVEVVVDD-
2391|hp|hla       WIVLGIAGGLYYQQTQSGGDAGAADDDDADASDE---PVEVIVDDD
1509|chp|hut      WLVLGVAGLLLYQQQS-----GEEGDVDTDAEDEDSEPVEVMVE--
5046|hp|nph       WLVLGVAAALFYQQQQS----GGDEELDDDEE-----PVEVVVED-
                  *:.: :.. : : :       .   . :         .***:*: