HOG COG KOG arCOG COG description NRC-1 annotation
nucHOG0047arCOG04626hypothetical protein

HOG Organism Gene ID Name Annotation
nucHOG0047 nrc1 VNG1412 vng1412 no entry
nucHOG0047 hmu HMUK2218 Hmuk_2218 conserved hypothetical protein
nucHOG0047 hma RRNAC1001 nac sodium-and chloride-dependent transporter
nucHOG0047 hwa HQ2792A hypothetical protein
nucHOG0047 hla HLAC2035 Hlac_2035 hypothetical protein
nucHOG0047 hla HLAC1392 Hlac_1392 hypothetical protein
nucHOG0047 hla HLAC1154 Hlac_1154 hypothetical protein
nucHOG0047 hbo HBOR13730 Hbor_13730 hypothetical protein
nucHOG0047 hut HUTA2948 Huta_2948 conserved hypothetical protein
nucHOG0047 hvo HVO_2861 HVO_2861 conserved hypothetical protein
nucHOG0047 nph NP1910A hypothetical protein
nucHOG0047 nph NP2604A hypothetical protein
nucHOG0047 hhi 1627 HAH_1627 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


10010|gene|hma      ---------------MSDRETWASRLGFLLAAIGSAVGLGNIWQFPFKTATNGGAVFLVF
1154|hp|hla         ---------------MSDTDTHDQTAEPITDEI-----HDNSWSANL-------------
1392|hp|hla         ---------MAPPTAGEDTSNPDSDDPSEVAVA-----LDEADDGLADAIESALAGRSAI
1910|hp|nph         ----------------METAQLESGVVGVVETA-----FTDGTDSLVVVDPSEETLAALV
2035|hp|hla         ----------------MVSNLLEADVENVLDAA-----FAGDDQELFVVDPSAETIVSLV
2604|hp|nph         ----------------MKSNLLERTMGDVLEAA-----LDAADDELFVINPDAEAIESLV
2792|hp|hwa         --------------MSLDANVLGTDMGHVLSSV-----LSEVTGAVYVVNPTQDLTKALV
1412|hp|nrc1        MRPIKLNSHTPYRWVEMTANLLGTTVADTLEGV-----FGDDPDELYVVDPSRHAVEALV
13730|hp|hbo        --------------MTIDSNMLTEDAERILRSV-----LDSGAEDVLVVDPTADVIDTLV
2948|chp|hut        ---------------MSTDNLIATDIRTVLEAA------VPATDRVTVVNPAPETIVALV
1627|hp|hhi         ----------------------------MLTTV-----FGATDEPVYVVNPSRRTISELV
                                                                                

10010|gene|hma      YLVAVLLIGFPAMLAEFIIGRRT------------NRNAVD-AFGELGFKQWRVVGGLGV
1154|hp|hla         --------------------EKP-------------------QY----------------
1392|hp|hla         VAVGVPLALLPPI---LAARERTRGGTWRVACRPGVADALGRAF----------------
1910|hp|nph         SAS--FDRTLPTL--LVLAEERT------------LKDAMG-DF----------------
2035|hp|hla         EAAIDRDD-LPEM--SMLVDERT------------LKDVME-DF----------------
2604|hp|nph         ET---LDAESPPV--CLFADSET------------LKDVLD-DF----------------
2792|hp|hwa         TDCSDILTNDTSV--RLLSDEQR------------LKEVMD-NF----------------
1412|hp|nrc1        EAANDYDTPLPTL--RVLADERT------------LKDVMD-DF----------------
13730|hp|hbo        AVASETEDGLPEI--RMIADESV------------LKDVMD-DF----------------
2948|chp|hut        STLEDHDS-APSV--RLLSPEHA------------LKQVMG-DF----------------
1627|hp|hhi         STL-DADSGAPEV--RLLADERA------------LKDVMD-DF----------------
                                                               :                

10010|gene|hma      FTGFWILSYYNVVGGWVMRYILGSATGAYFGNSAEYFGAIASGPEAVVGQALFLLICVGI
1154|hp|hla         -------------------------------------------------------ADDAE
1392|hp|hla         ----------------------------------------------VLGTAVAEAVAEGA
1910|hp|nph         ----------------------------------------------VVASKAAALVEEGD
2035|hp|hla         ----------------------------------------------LVASKAADLVADGV
2604|hp|nph         ----------------------------------------------LVASRAADHIEADR
2792|hp|hwa         ----------------------------------------------IVASNAAELVDSNV
1412|hp|nrc1        ----------------------------------------------IVASTAANLVEDGS
13730|hp|hbo        ----------------------------------------------IVASNAADLVESES
2948|chp|hut        ----------------------------------------------LVASSAADLIDDGT
1627|hp|hhi         ----------------------------------------------LVASTAADLIDEER
                                                                                

10010|gene|hma      VAVGVEDGIEKAT--KVMVPSIVLLMIGMAAWVTTLEGAGAGYSYFLSPDFSTLAANAGD
1154|hp|hla         LAVRDALVAIDHT--------------TAGNHVNLVTHGDLG-----------------H
1392|hp|hla         IELRTVADEPDVQRILFASPDRIDAVVGPEKDRTLVTEEAPK---RVTPAGRAVRERFAA
1910|hp|nph         LSLRVLSEPADNS--VFAAEDQIVAPVPTGDGVAALSTDDGV---VVDDVYESYHDRFET
2035|hp|hla         LDLRLLGETVDNA--LFVSPSRVVVLVSTDDRVAALASDDDE---FVAEVFETHSDAFAD
2604|hp|nph         LEIRVNDAAA-NS--LLVTADAVVAVVRGDDQVAGLTTDDEA---FIDSAYQRITGEWAD
2792|hp|hwa         LTLRVDDVSEPNS--LIVTTSATVAMIQTNNQVAGLIADEIE---FVTSVRDSYEQAFES
1412|hp|nrc1        LALRTVDVENRSP--MLVTEERAIALLETGRFVGGLATDDDD---LAETAYDAANTDWAA
13730|hp|hbo        LSMRTTDNGTANA--LLITKDAVVSLVTAGDQVAGLVTTDDE---FVAAAYDTYTMQWEE
2948|chp|hut        LSLRVLDEQPVNS--LVVTDDAVVSLVTATDAAAGLTTDDGE---FVASTVAFYDDVWET
1627|hp|hhi         LTMRLLDDVPNHS--VAVTVDTVYALVTISDTVGGLGTDDAA---FVDNAYDYYGSTWED
                    : :                                :                        

10010|gene|hma      LIPFAVGQAFFTLSLGMAAMITYSSYIGDDESLPVDGGIIVVTNTLVGVLAGLVVFPILF
1154|hp|hla         PEEFL-------------------------------------------------------
1392|hp|hla         ATPET---------VDMPARSRLLAAACET------------------------------
1910|hp|nph         ALDYD---------LRTPSITRVRETLEEA------------------------------
2035|hp|hla         AETYG---------LRTPAISRVRETMAAE------------------------------
2604|hp|nph         AENFN---------LRTPSLIRVRETLTDE------------------------------
2792|hp|hwa         ATSYP---------LQTPAISSVRSTLASE------------------------------
1412|hp|nrc1        ADEFA---------LRTPAIDRVRETLGDD------------------------------
13730|hp|hbo        APQYK---------LRTPPIERVRATLEEE------------------------------
2948|chp|hut        ASEFS---------LRTPPLSRVRSTLAAE------------------------------
1627|hp|hhi         ADEYS---------LRTPPLNRVQSTLEAD------------------------------
                                                                                

10010|gene|hma      AINVSPDTSGPSAIFVAMASAFPQLPGGRLLGVVFFGVVLIAAISSAISLLEVTVSY---
1154|hp|hla         --------------YDAI---------EREYGLDP--------------------EY---
1392|hp|hla         ---LDDRFADD---VAAVLDALPYGAVGRTGEVTDRTLLVALAARHDHLLWDLR-RWIGD
1910|hp|nph         ---LDEQTRAD---FDAVLEAVP-EVRSRGDSLDEVSILLLLTAKNGNLLYDIS-KW---
2035|hp|hla         ---IGEATRED---FDAVLAAMD-SARGADGEVDEVTVALLVAAKNDVLLYDIS-KW---
2604|hp|nph         ---LGESTREN---FDAVLDALE-TARGDGEGLDEVTISLLVAAKNEDLLYDIS-KW---
2792|hp|hwa         ---IGDETRSD---FDSVLTTLQ-TARDDRSALNEVIISLLVAAKNNVLLYDIS-KW---
1412|hp|nrc1        ---INADVGDD---FDDVLASLE-TARGDGEGLDEVTISLLVAAKNRELLYDIS-KW---
13730|hp|hbo        ---ISADARDD---FDSVLSSLQ-TARGDGDGLDEVTISLLVAAKNEVLLYDIS-KW---
2948|chp|hut        ---ISEDARAD---FDAVLDSLS-TARSDDGGIDEVTISLLVAARNRELLYDIS-KW---
1627|hp|hhi         ---IGPETASD---FNDVLSSLS-TARGDGDGLDEVTISLLVAARNGELLYDIS-KW---
                                     :              :                       :   

10010|gene|hma      ------GVDNTSYSRVSLAAMLGVVLFVLGFPSAWDLAWFGWFDTLAYKLFLPLSVLLIL
1154|hp|hla         ------VEQCGC------------------------------------------------
1392|hp|hla         GADGGSAEGVGIAAGQDLT------------DDRRALVRRGLIEAIK----MPAGD----
1910|hp|nph         ------GEDVGVASKATFS------------RTKTDLEDAGLLDTEK----VPIDV----
2035|hp|hla         ------GEDVGIASKATFS------------RTKTRLEDLGIIDTEK----VPIDV----
2604|hp|nph         ------GEDVGIASKATFS------------RTKTRMEDNGILGTEK----VPIDV----
2792|hp|hwa         ------GEDVGIASKATFS------------RTKTELEESGLIDTEK----VPIDV----
1412|hp|nrc1        ------GEDVGIASKATFS------------RTKTKLEDLGLVDTEK----VPIDV----
13730|hp|hbo        ------GEDVGIASKATFS------------RTKTKLEEMGLIDTEK----VPIDV----
2948|chp|hut        ------GEDVGLASKATFS------------RTKTQLEDKGLLDTEK----VPIDV----
1627|hp|hhi         ------GEDVGLASKATFS------------RTKTKLEDMNLIDTEK----VPIDV----
                                                                                

10010|gene|hma      VFVGWVLSSNAVAELRQGTGGLRAFGPTWLWMVRTVVILGVLLTLVLGLQTLFLAEDPAI
1154|hp|hla         --------GGHVTRVQVA------------------------------------------
1392|hp|hla         --------GRPQLRLRAVDDALLRATPEEVLSVLRGRFALPVDEDGRVRQPPGRDERRPV
1910|hp|nph         --------GRPRLRLKLGDNRLQGRDAVDLVETAADILN---------------------
2035|hp|hla         --------GRPRLRLKLGDERLNGLDAAELAAEVAEMMA---------------------
2604|hp|nph         --------GRPRLRLKLGDDNLRGADIGSLVESTQSMLE---------------------
2792|hp|hwa         --------GRPRLRLKLGHNQLVRASSDQLAGVAESLLA---------------------
1412|hp|nrc1        --------GRPRLRLKLADDRLEDAPAPEFANVAESMLA---------------------
13730|hp|hbo        --------GRPRLRLKLGDDRLVNADPDQLAGVAQSLLA---------------------
2948|chp|hut        --------GRPRLRLLLGEQRLQDADADELADVAIELLSS--------------------
1627|hp|hhi         --------GRPRLRLMLGDDRLKDAEPDELASVAQSILAA--------------------
                            .     :                                             

10010|gene|hma      IPPI-----
1154|hp|hla         ---------
1392|hp|hla         WERTRRDKN
1910|hp|nph         ---------
2035|hp|hla         ---------
2604|hp|nph         ---------
2792|hp|hwa         ---------
1412|hp|nrc1        ---------
13730|hp|hbo        ---------
2948|chp|hut        ---------
1627|hp|hhi         ---------