HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0469COG1246arCOG00840ArgA-like acetyltransferase

HOG Organism Gene ID Name Annotation
cHOG0469 nrc1 VNG0482 act2 ArgA-like acetyltransferase
cHOG0469 hmu HMUK2893 Hmuk_2893 GCN5-related N-acetyltransferase
cHOG0469 hma RRNAC0639 acetyltransferase
cHOG0469 hwa HQ2643A homolog to acetyltransferases
cHOG0469 hla HLAC0941 Hlac_941 GCN5-related N-acetyltransferase
cHOG0469 hbo HBOR16400 Hbor_16400 acetyltransferase, N-acetylglutamate synthase- like
cHOG0469 hut HUTA2471 Huta_2471 GCN5-related N-acetyltransferase
cHOG0469 hvo HVO_1584 HVO_1584 acetyltransferase family
cHOG0469 nph NP1474A homolog to acetyltransferase
cHOG0469 hhi 1296 argA1 acetyltransferase
MUSCLE (3.6) multiple sequence alignment


482|hp|nrc1         MHTRDAKNHEEVWLLDRLDDYGFEDPAFRSRDYVLAVDEATNERAGFARFRVHTPDDTA-
2643|gene|hwa       MYVRDAKNRDEAWLLDWIEEAEIEDPAFRSRDYVIALNEETSRKAGFGRIRNHSGDSGT-
16400|gene|hbo      MYVRDAKNREEVWLLDRIEESGLEDPAFRSRDYVIALDEGTNTKAGFGRIRVHKDEGEE-
941|gene|hla        MYIRDAKNRDEAWLLDAIEQLGLDDVAFRSRDYVIAVDEESGDRAGFGRLRLHRGDEEEE
1474|gene|nph       MYVRDARNRDEAWLLDHIEAMGLDETSFRSRDYVIAVDEESNARAGFGRIRVHSDDGTE-
2471|gene|hut       MYVRDAKNRDEVWLLDRIEEMGLDETAFRSRDYVIAVDEQSNDRTGFGRIRIHKGEDGD-
10639|gene|hma      MYVRDAKNREEVWLLDRIEEMGLDETAFRSRDYVVAIDEESHEKAGFGRIRIHKGGDEP-
1296|gene|hhi       MYVRDAKNREEVWLLDRIEEMGLDETAFRSRDYVVAIDEESHEKAGFGRIRIHKGDEES-
                    *: ***.*.:*.**** ::   ::: :*******:*::* :  .:**.*:* *       

482|hp|nrc1         RVCEFTNIGVLDDWRGRGVGAHLLAYLVADAREQGIEEAYALTDEPAYLDQFGFERVDEA
2643|gene|hwa       -FCELTVLFTLPMWRNQGVGAHVIERLVAEAADEQYETVYVFTTEPGYFTMFGFQPQESG
16400|gene|hbo      -WCELAFVFTLPAWRDQGVGAHVVERLLTKASDEEFDRVYTFTVEPDYFLTFGFQPVDSD
941|gene|hla        NRIELTGIGVLPEWRDRGVGAHVIERLVDTAAADRFETVYVLTDQPEYLTQFGFERVDTD
1474|gene|nph       -VCELTSIGVLDGWRRQGVGAHVIERLVDSAETEAFERVYSLTSAHDYLAQFGFEPVAEA
2471|gene|hut       -VCELTSIGVLESWRGQGIGAHVVERLVQEAGDQDFETVYSLTDEPEYLTKFGFEPIDPS
10639|gene|hma      -VCELTSIGVLPEWRNQGVGAHVIERLVEYAGDEGFDTVYSLTNASEFLAQFGFERIEPA
1296|gene|hhi       -VCELTSIGVLPEWRNQGVGAHVIERLVEYAGDEGFDTVYSLTNASEYLSQFGFERIEPA
                       *:: : .*  ** .*:***::  *:  *  :  : .* :*    ::  ***:     

482|hp|nrc1         ELPPPLGDRLAATRES-QPDA---EALCVAFDAFEVPERLQRRFAGDDGSDDA-------
2643|gene|hwa       QLDPHVTDRFETVRESRESNNNRFVALSINTGELTVPQRLRDRFKRAHPSDEPPEGEVVI
16400|gene|hbo      DLPEILQERLETVREERGEDA---IAMRIQPGRFRMPDELREQFKRATPADAPDEVQI--
941|gene|hla        DLPEALSDRLDEKREFLGGDV---VGLHLAVDDFEMLDRFREAFKAAEPADAAAD-DA--
1474|gene|nph       ELPDVLAERLEAKQDTLDPDA---VPMRLDIDAFGMPERLRERFK--TAAEDAEPAEP--
2471|gene|hut       DLPPSLQDRLETKRESLLPDA---VPVELAVEAFTMPQHLRDAFKAAAENEGPS--EP--
10639|gene|hma      QLPDALRDRLATKQENIQPDA---VPLRVAVDRFEVPGHLRKQFKQASAGESEEP-EP--
1296|gene|hhi       QLPDRLRDRLATKQENIQPDA---VPLRVAIDRFEVPGHLRKRFKQASAGESEEP-EP--
                    :*   : :*:   .:    :      : :    : :   :.  *      :         

482|hp|nrc1         -DAGEDFGIDSDTATYKYDTGG
2643|gene|hwa       EETAEDFGIDPTETTYKYDTG-
16400|gene|hbo      EETAEDFGIDPEETTYKYDTGR
941|gene|hla        TESPEDFGIDPESATYKYDTGR
1474|gene|nph       PEEAEDFGIDPDEATYKYDTGS
2471|gene|hut       EESAEDFGIDPDEATYKYDTGS
10639|gene|hma      EEGPEDFGIDPDEATYKYDTGD
1296|gene|hhi       EEGPEDFGIDPDEATYKYDTGD
                     :  ******.  :*******