HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0468COG0423KOG2298arCOG00405Glycyl-tRNA synthetase (class II)glycine-tRNA synthetase

HOG Organism Gene ID Name Annotation
cHOG0468 nrc1 VNG2352 glyS glycine-tRNA synthetase
cHOG0468 hmu HMUK0796 Hmuk_0796 glycyl-tRNA synthetase( EC:6.1.1.14 )
cHOG0468 hma RRNAC2701 glyS glycyl-tRNA synthetase
cHOG0468 hwa HQ3709A glyS glycyl-tRNA synthetase
cHOG0468 hla HLAC0293 Hlac_293 glycyl-tRNA synthetase
cHOG0468 hbo HBOR01650 Hbor_01650 glycyl-tRNA synthetase( EC:6.1.1.14 )
cHOG0468 hut HUTA1488 Huta_1488 glycyl-tRNA synthetase
cHOG0468 hvo HVO_0054 HVO_0054 glyS glycyl-tRNA synthetase
cHOG0468 nph NP0328A glyS glycyl-tRNA synthetase
cHOG0468 hhi 3097 glyS glycyl-tRNA synthetase
MUSCLE (3.6) multiple sequence alignment


2352|gene|nrc1      --------MSETVSELARRRGFFFQASEAYGGAAGFYTYGPEGAALKRNIEDAWRDRFVT
1488|gene|hut       ----MTSVSAEALVELAKRRGFFLQSADAYGGVSGFYTFGPQGAAMKRNVEETWRDRFAI
328|gene|nph        ------MSELETLTELAKRRGFFFSSNEAYGGTAGFYTYGPEGAALKRNLEDIWRDIFVR
293|gene|hla        -------MASEEIGELAKRRGFFFGSNGAYGGTAGFYTFGPQGAALKKNVEDAWRDRFTI
3709|gene|hwa       MSTKEDQTEGERLAELAKRRGFFFGSNGAYGGVAGFYTFGPQGAALKSNIEAAWRERFTV
1650|gene|hbo       --MTADRTEGERLTELAKRRGYYFGSSEAYGGTAGFYTYGPQGAALKSNVEDAWRERFTV
12701|gene|hma      ------MSEGERLTELAKRRGFYFPSSSAYGGAAGFWTYGPQGAALKSNIEDAWRDRYVV
3097|gene|hhi       ------MSEGERLTELAKRRGFYFPSSSAYGGAAGFWTYGPQGAALKSNIEDAWRDRYVV
                              * : ***.***::: :  ****.:**:*:**:***:* *:*  **: :. 

2352|gene|nrc1      REGNMEIDSPTVTPEPVFQASGHLDDFDDMLVECPDCGESHRADHVIED-NTDVEDAESM
1488|gene|hut       QEGHMEIDAPTVLPEPVFEASGHLDGFDDMLVECPECGQSHRADHIVEDGETGIEEAESL
328|gene|nph        ELGNMELEAPTVMPEAVFEASGHLDGFDDMIIECPECGATHRADHLVEDEIEDIEDAEAY
293|gene|hla        REGNREIEAPTIMPEAVFEASGHLEGFDDMLVECPECGESHRADHLVEA-VTEIEDAEAL
3709|gene|hwa       REGNYEIEAPTIMPEPVFEASGHLDGFDDMLVECPDCGTAHRADHLIED-ATDVEDAESA
1650|gene|hbo       QEGNLEIDAPTIMPEPVFEASGHLDTFDDMLVECPECAESHRADHLIED-NSDLEDAETL
12701|gene|hma      KEGHQEISAPDVMPEPVFEASGHLDGFDDMIVECGECGATHRADHLVED-NTDIEEAESL
3097|gene|hhi       KEGHQEISAPDVMPEPVFEASGHLDGFDDMIVECGECGATHRADHLVED-NTDIEEAESL
                      *: *:.:* : **.**:*****: ****::** :*. :*****::*     :*:**: 

2352|gene|nrc1      PTDEVEALIADHELVCPACGGPLAGQSVTGFNLMFDTTIGPGDGDPGYLRPETAQGMFTE
1488|gene|hut       APERIEEVVAEYELACPTCGTGLAGQAIEQFNLMFETNIGPGSSSPGYLRPETAQGIFIE
328|gene|nph        EPTEVAELIATHHIECPSCGESLAGESVEEFNLMFGTNIGPGSSAPGYLRPETAQGIFVE
293|gene|hla        PGSEVEELIADNDIACPSCGTPLAGVTVEDFNLMFATDIGPGDGQPGYLRPETAQGIFVE
3709|gene|hwa       PIEEVEDLIIEHNLVCPQCQATLGGEPVDSFNLMFETNIGPGSASSGYLRPETAQGIFVE
1650|gene|hbo       SLEEAAEEIAALDLVCPNCGAELAGQSVDNFNLMFETNIGPGSSDPGYLRPETAQGIFVE
12701|gene|hma      PNEEVMDLIAEHGIECPSCHTSLADQPVDNFNLMFETNIGPGSSSPGYLRPETAQGIFVE
3097|gene|hhi       PNEEVMDLIAEHGIECPSCHTSLADQPVDNFNLMFETNIGPGSSSPGYLRPETAQGIFVE
                            :    : ** *   *.. .:  ***** * ****.. .**********:* *

2352|gene|nrc1      FPRLKEYARNQLPFGVAQVGTGYRNEISPRNALLRTREFTMAELEFFVDPAGDGPALDRV
1488|gene|hut       FPQFAEYARNQLPFGVTQIGRAYRNEISPRKSLLRVREFTQAELELFVDPEEDEPDLSAV
328|gene|nph        FPRLKEYARNKLPFGVAQIGRAYRNEISPRRALVRVREFTQAELEHFIDPERDEPPIDRV
293|gene|hla        FPRLKEYARGNLPFGITQIGPAYRNEISPRGGLLRLREFTQAELEQFIDPEEDEPPLDRV
3709|gene|hwa       FPQIKQYARNTLPFGVTQIGRAYRNEISPRKRIVRTREFTQAELEQFIDPERDEPALDEV
1650|gene|hbo       FPRIKEYARNRLPFGVTQVGRAYRNEISPRKSIVRTREFTQAELEQFIDPERDEPDLSAV
12701|gene|hma      FPQLSEYARNQLPFGVAQIGKAYRNEISPRKSLVRVREFTQAELEHFIDPEEDEPPLAEV
3097|gene|hhi       FPQLSEYARNQLPFGVAQIGKAYRNEISPRKSLVRVREFTQAELEHFVDPEEDDPPLAEV
                    **.: :***. ****::*:* .********  ::* **** **** *:**  * * :  *

2352|gene|nrc1      ADVELPLYPVDAQQAAGEEYLRLTPQEALAEGVVGGEWVAYFLARSKQWFERVGVDMDRF
1488|gene|hut       ADVTAQFYPAEAQDRADGEPVEMTIGEAVEDGIVADPWIAYYLGVAAEWYAAIGLDMDRF
328|gene|nph        ADVELPLYSVANQNAENGGVETYTVAEAVDSGIIESEWVAYYLGRSMDFYERIGIDMDRF
293|gene|hla        RDVSVRLYPATEQQAEDGEYVETTIGEAVDEEIIGSPWVGYYLGVAKEWYDRIGVDLDRF
3709|gene|hwa       ADITVTLYSARQQQADDGDYIETTVGEAVESGLIGDGWIGYFIGIAQEWYETIGVDTDRF
1650|gene|hbo       EDVAVLLYPATEQQKDDGDYIETTIGAAVEDGSIGNAWLGYFLGIAQEWYERVGVDMDRF
12701|gene|hma      EDVVLPLYAAAEQQTDDGGQRELTVREAVDEDIVESEWVAYYLGVSKEWYERIGVDMDRF
3097|gene|hhi       EDVVLPLYSAAAQESEDGGQRELTVREAVDEGVVESEWVAYYLGVSREWYERVGVDMDRF
                     *:   :*..  *:  .      *   *: .  : . *:.*::. : :::  :*:* ***

2352|gene|nrc1      RFRQHLPGELAHYASDCWDAEGEV-----DGDWVELEGVASRTDYDLSKHDEHADDSFTV
1488|gene|hut       RFRQHRPGELAHYSEDCWDAEGDVSDPDEDPDWIELGGFAYRADYDLSKHDAHSEAEFTI
328|gene|nph        RYRQHLPGERAHYAADCWDAETEL-----GGSWVEVTGFAYRSDYDLSKHGDYSKEEFTL
293|gene|hla        RFRQHLAGERAHYASDCWDAESEV-----DGDWIEIAGFSYRADYDLSKHDEYGDDAFTV
3709|gene|hwa       RFRQHLSGERAHYATDCWDAESEV-----DGDWIEIAGFAYRGEYDLSKHAEYGDDEFSI
1650|gene|hbo       RFRQHLAGERAHYSSDCWDAESEV-----DGDWIEIAGFSYRSDYDLSKHAEYSEEDYTV
12701|gene|hma      RYRQHLAGERAHYASDCWDAESEV-----DGDWIEITGFAYRGDYDLSKHAKHSGEDYTV
3097|gene|hhi       RYRQHLAGERAHYASDCWDAESEV-----DGDWIEITGFAYRGDYDLSKHAEHSGEDYTV
                    *:*** .** ***: ****** ::     . .*:*: *.: * :******  :.   :::

2352|gene|nrc1      FQAYDEPKTVERASVDPEMSYLGPEFGGAAGDVADALAALAARDRAAFDGDEVTVDVDGE
1488|gene|hut       FKQYDDPVTVEQPTVDPEMGYLGPEFGGAAGDVADALEALAEDDPDAFAGEDVTVEVDGE
328|gene|nph        FRQYDEPKTVERATVDPDMSYLGPEFGGAAGDIAAALESLAGRDRSAFDGDEVTVEVDGD
293|gene|hla        FKRYDEPKTVERATVDPDMSVLGPEFGGDAAAVAEALETLAERDPDAFDSETVSVEVNGD
3709|gene|hwa       FQEYEESKTVERAVVDPDMSVLGPKFGSQAGEIKTALETLAERNPDAFSEETVDVSVDGE
1650|gene|hbo       FRQYDEPKTVERAVVDPDMSVLGPKFGGAAGDVKDALERLAERDPDAFDGDEVTVEVDGE
12701|gene|hma      FKQYDEPITVDRATVDPDMSYLGPEFGGSAGAVADALEALAERNPDAFDDDEVTVEVDGK
3097|gene|hhi       FKQYDEPITVERATVDPDMSYLGPEFGGDAGAVADALEALAERNPDAFDDDEVTVEVDGE
                    *. *::. **:.. ***:*. ***:**. *. :  **  **  :  **  : * *.*:*.

2352|gene|nrc1      AYTVPTERTGFEVAEETESGRHIIPHVVEPAFGIGRAVYTALAHSYEADEVDGEPRDVLR
1488|gene|hut       AYTVPVEQTGFAIEEVTESGEHIMPHVVEPSLGIDRALYTALDHSYREDEVDGEERTYLE
328|gene|nph        EYTVPVERTGFAVEEQTEAGEHITPHVVEPSFGVGRLVYSVLVHSHGTDTVDDEERTYLD
293|gene|hla        DQTVDTDVANFSVETVTENGEHLTPHVVEPSFGVGRTVQTLLAHAYSEDEVDGEERTYLS
3709|gene|hwa       IMTVDVEETNFHIESKTVNGEHITPHVIEPSFGIDRTVYTLLAHGYREDTVDNETRTYLS
1650|gene|hbo       THTVETDVTNFAVEEQTINGEHITPHVVEPSFGVDRTVYTLLAHAYEEDEVDDEERTYLS
12701|gene|hma      SHTVPVDKTNFSVDEVTENGEHIRPHVVEPSFGVGRIIYTVLAHSYETDEVDGEERTYLD
3097|gene|hhi       SHTVPVEQTNFSVDEVTENGEHIRPHVVEPSFGVGRIIYTVLAHAYETDEVDGEERTYLD
                      ** .: :.* :   *  * *: ***:**::*:.* : : * *.:  * **.* *  * 

2352|gene|nrc1      LPAEVAPTTVGVFPLMDK-DGLGERAREIAAELRAAGLAVTYDDSGNIGRRYRRQDEVGT
1488|gene|hut       LPPAVAPTTVGVFPLMDK-DGLGERAREIAAELRADGLAVAYDDSGAIGRRYRRQDEVGT
328|gene|nph        LPAELAPTTVAVFPLMTK-DGLDDRAREVSETLREAGFEVAYDDTGNIGRRYRRQDEVGT
293|gene|hla        LEPEVAPQDAAVFPLVTNDDRLTELADRVAADLREAGVAVAYDDSGSIGRRYRRQDEIGT
3709|gene|hwa       LSTKVAPTDVGVFPLISNVEQLVEQAKDIVSELRAAGLSVVADDSGSIGRRYRRQDEIGT
1650|gene|hbo       LSPEVAPRDVGVFPLVSNVPELVDLADEIVDDLRAAGLSVVYDDSGSIGRRYRRQDEVGT
12701|gene|hma      LPPEQAPTTVGVFPLMDK-DGMADLATDIADDLRAAGLSVTYDDSGAIGRRYRRQDEVGT
3097|gene|hhi       LPPEQAPTTVGVFPLMDK-DGMADLATDIADDLRAAGLSVTYDDSGAIGRRYRRQDEVGT
                    * .  **  ..****: :   : : *  :   **  *. *. **:* **********:**

2352|gene|nrc1      PYCVTVDYEALEEGA------------------------------------VTLRDRDTT
1488|gene|hut       PYCVTVDYDTLEDGT------------------------------------VTIRDRDST
328|gene|nph        PYCVTVDYETQEDGT------------------------------------VTIRERDST
293|gene|hla        PFCVTIDRDGIEGDGPE---------------------------------TVTVRERDSA
3709|gene|hwa       PFCITVDRDGIEGTDPD---------------------------------TVTIRQRDTG
1650|gene|hbo       PFCITVDRDGLESDGET---------------------------------TVTVRERDSG
12701|gene|hma      PYCVTVDYESLEDDSEAQRASDSASSAEPRSANRSSGQSPREDGDEPRAGTVTVRERDTT
3097|gene|hhi       PYCVTVDYESLEDSE------------------------------------VTVRERDTT
                    *:*:*:* :  *                                       **:*:**: 

2352|gene|nrc1      TQVRVPIAEVAETLVGLRDGELRFEAL--------------
1488|gene|hut       DQTRVAADDLASTIEALVEGDSTFQNL--------------
328|gene|nph        DQTRVPVEGLPAAIAELVDGA-TLAEL--------------
293|gene|hla        VQVRVPAEELATELTALRTGG-EFDALVDRYETVATDVETN
3709|gene|hwa       RQVRAPIAVVTELIQSVQSDEIIFDNLTDAYDAVEWANKSE
1650|gene|hbo       RQIRVPVSALADELGAVRGGDRTFDDLAAEYDELTDD----
12701|gene|hma      EQKRLPIDGLAETLEQLSTGDRTFDDL--------------
3097|gene|hhi       EQKRLPIDGLADRLERLATGDLTFDDL--------------
                     * * .   :.  :  :  .   :  *