HOG Organism Gene ID Name Annotation
aHOG4674 nph NP1860 htr26 transducer protein htr26
aHOG4674 nph NP2760 htr25 transducer protein htr25
MUSCLE (3.6) multiple sequence alignment


1860|gene|nph      MTYLDRLRAMLARLRPGGGSSDSAGDAETTGGARTTKRPDGGRAMQAGDAPALEDIGLRS
2760|gene|nph      -------------------MSDS-----TDGGE--DPRPDGA------------------
                                       ***     * **     ****.                  

1860|gene|nph      EIDETQLLSAIGLDDDEIDWRKEFVGFDETDAERLSSLTPVFEEMADDAADHFYDHLGQY
2760|gene|nph      ------------------------------------------------------------
                                                                               

1860|gene|nph      EQTRSILDRSDRSVDELEWTQKRYLLSLGDHPYIPGGAPGYGREYFRQRAIIGKLHERLD
2760|gene|nph      ----------------------------------------------------GTLAER--
                                                                       *.* **  

1860|gene|nph      MPPKHYIGMYGQYHDMVVEELFDRLEDEVDGDAATAVADTRDQLRSFLKVTNLDLQVAMD
2760|gene|nph      ------------------------------------------------------------
                                                                               

1860|gene|nph      AYLQSGEQI-WINALEELLQPVIVLDNEG---EVLLFNDAMEELTGVTKDDAHSMELWEI
2760|gene|nph      -----GNGIRWEQALNDMPLPIVVADFHGGDTELIIFNDLMEEMTGLTKAEAQEMDAWEI
                        *: * * :**:::  *::* *  *   *:::*** ***:**:** :*:.*: ***

1860|gene|nph      YRTDETHDTKQTMLDVVLETEDPIRENEIELLTHHDERRHVVLSSVPLYDDHGALVGGAT
2760|gene|nph      YRTDETHDTKQTMAERVRELGEPIRDHETELLDHDGNLHQVVISSTPIFDERGDVRATMT
                   ************* : * *  :***::* *** * .: .:**:**.*::*:.* : .  *

1860|gene|nph      IIQDITDLREQEAELERRRE-TATQIEAAIAELRDATAAVAEGSDEIAALADRQRDDVQG
2760|gene|nph      SFRDVTELRDKEEALQATQEQVAGTLDEAVSQLEAVAERVVDNAENIQQRASEQDDSLQD
                    :.*:*:**::*  *:  .* .*  :: *:::*  .:  *.:.:::*   *. * *.:*.

1860|gene|nph      VADEVSNISASIEEVAASADQVHTASNETVSLATDGQEAAGEARELMEQLDADRAEMLDD
2760|gene|nph      VAREMESLNASMEEVAASTDELAEAADEMRSAADEGRSAAEDAQEATDELLETGESLVDT
                   ** *:..:.**:******:*::  *::*  * * :*..** :*.*  ::*     .::* 

1860|gene|nph      IDDLRDAAEEIGDIVDIIDDIAEQTNILALNASIEAARADEAGDGFAVVADEVKSLAEES
2760|gene|nph      VSALESEIGEISEVVDLIADIADQTNILALNANIEAARADAEGGGFKVVADEVRNLAEES
                   :. * .   **.::**:* ***:*********.*******  *.** ******..*****

1860|gene|nph      QQQAAEIESLVAAVQENTEETAANLERTGERVGDGVDHVESVLEKLDAIVAAARETADGI
2760|gene|nph      QAHAADIREQIAVVEEKATETVAETETASERIEETGDRIQESLSALEGIAERIEESTSGI
                   * :**:* . :*.*:*:: **.*: * :.**: :  *.::. *. *:.*.    *::.**

1860|gene|nph      EEVAEATDGQAASTEEVAAMVDQTAAQARDVATEIEDIAEAAQSQLEQAQTIEEGITELT
2760|gene|nph      EEIADANTDQATRAEEVTATVDEVADRAQLVREAAGETVEAAETQRDVVGEVSAAVTQLR
                   **:*:*. .**: :***:* **:.* .*. *     : .***::* : .  :. .:*:* 

1860|gene|nph      QTDDET
2760|gene|nph      DRTDQK
                   :  *:.