HOG Organism Gene ID Name Annotation
aHOG4670 nph NP2086 flg_1 flagellin precursor 1
aHOG4670 nph NP2088 flg_2 flagellin precursor 2
aHOG4670 nph NP2090 flg_3 flagellin precursor 3
MUSCLE (3.6) multiple sequence alignment


2088|gene|nph      MFEQFTESEERGQVGIGTLIVFIALVLVAAIAAGVLINTAGFLQTQAQATGEESTEQVST
2086|gene|nph      MFETLTETKERGQVGIGTLIVFIALVLVAAIAAGVLINTAGFLQTQAQATGEESTEQVST
2090|gene|nph      MFEQFTESEERGQVGIGTLIVFIALVLVAAIAAGVLINTAGFLQTQAQATGEESTEQVST
                   *** :**::***************************************************

2088|gene|nph      NLVFLSTTGTV----SDAEDGIDSFNTTVQLGPGSSAIDLNDTTISVFTDDGQSQEFSGV
2086|gene|nph      NLVYLSTTGEVVEDGTGSLVGIDQFETTVQLGPGSSAIDLNDTTISVFTDDGESEEFDGV
2090|gene|nph      NLVYLSTTGTV----SNSEDGINQFETTVQLGPGSSAIDLNDTTISVFTDDGESEEFD--
                   ***:***** *    :.:  **:.*:**************************:*:**.  

2088|gene|nph      DEDTDNNDGGIEFEDDSRDSSVLSTDSTDDDATATIEFDIGDANELSEP----FEEGTTV
2086|gene|nph      DEGDSLTDDGIEFDDTDRDSSVLSTDATDDDATATIVFGLDDASDGINPEDDRFDEGTTV
2090|gene|nph      ----SLAEDGIELEDRSDDEAVLSTASSDDDATATIVFDLTDG-DGIDPEDGQFDEGTTV
                       .  :.***::* . *.:**** ::******** *.: *. :  :*    *:*****

2088|gene|nph      DIVITTSEGTQAENSFIIEDPLDPQLEGG------DEIRLD
2086|gene|nph      DIVITTAEGTQAENSFIIEDPLDPQLDDE------DEIRLD
2090|gene|nph      DIVITTAEGTQAENSFIIEDPLDPQLDGNTDPDQADEIRLG
                   ******:*******************:.       *****.