HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0467COG1624arCOG04453Uncharacterized conserved proteinhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0467 nrc1 VNG1389 vng1389 no entry
cHOG0467 hmu HMUK2246 Hmuk_2246 protein of unknown function DUF147
cHOG0467 hma RRNAC1103 nps putative sodium/phosphate symporter
cHOG0467 hwa HQ2563A hypothetical protein
cHOG0467 hla HLAC1442 Hlac_1442 protein of unknown function DUF147
cHOG0467 hbo HBOR15520 Hbor_15520 uncharacterized conserved protein
cHOG0467 hut HUTA0301 Huta_0301 protein of unknown function DUF147
cHOG0467 hvo HVO_1660 HVO_1660 Domain of unknown function DUF147 family
cHOG0467 nph NP4194A hypothetical protein
cHOG0467 hhi 1713 HAH_1713 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


11030|gene|hma      MSDGRTGRVLLIVAVLAVAAAARLTTLHWTPLPSTLDGFGYVALARDTLRTGTFPLTRFR
1389|chp|nrc1       --------MTRPPDLLADVLDGIDALLVFSPSGSYYDRVDDVEG-VDVVVVAT-------
301|hp|hut          --------MSQIDDVLGRLSADLDAIFLFAPSNSLYDELAEAYT---VIVVGA-------
1713|hp|hhi         --------MNELRDLLGDLVADVDAVFLFSPNASFFEEFDDVDE--EIVVVGP-------
1442|gene|hla       --------MASLTDHLSDLVEGADAVLLFSPTSSFFNRFEDGDT--EIVVVAP-------
2563|hp|hwa         --------MAVLSDLVDDIIADIQGLVMFSPTGSRYERFINADLEYPIIVVAP-------
4194|hp|nph         --------MSELSDLLDDIVADVDGVFLFSPSGSFYERFGESDP----VVVAP-------
15520|hp|hbo        --------MVALSDLLDNVVADVDALFIFSPSSSYYERFADADLDTPVVVVAS-------
1660|hp|hvo         --------MAALSELLGDLVADVDGLFLFTPSSSHYEQFAETDV--PTVVIAP-------
                            :      :          . ::*  *  : .         :  ..       

11030|gene|hma      ADNIVFTAVLTVVGSLTGERPLYIAQPVVAVTGAASCLTAMALVKRLAQSSRWRHSRTTL
1389|chp|nrc1       ------------------------------------------------------------
301|hp|hut          ------------------------------------------------------------
1713|hp|hhi         ------------------------------------------------------------
1442|gene|hla       ------------------------------------------------------------
2563|hp|hwa         ------------------------------------------------------------
4194|hp|nph         ------------------------------------------------------------
15520|hp|hbo        ------------------------------------------------------------
1660|hp|hvo         ------------------------------------------------------------
                                                                                

11030|gene|hma      AMGVVGMGLAVEGIYLRRTGQTDEEALAFLLLPLFAIAVHRLLTTDRYRRRWGAVVVVLF
1389|chp|nrc1       --------------------ENAVGAETFVELPL-------AFDDVREQIRFGIE-----
301|hp|hut          --------------------ENGPDAERFVELPL-------DFTAIDDRVRFGVE-----
1713|hp|hhi         --------------------ENTLDAEPFVELPI-------DFTDLEGRLRFGIE-----
1442|gene|hla       --------------------DNDVDAEVFVELPL-------PFDNVKDRIRFGIE-----
2563|hp|hwa         --------------------ENNVNAATYIELPI-------EFDDARDQIRFGIE-----
4194|hp|nph         --------------------ENDVGADRYVELPL-------AFKDVSERIRFGIE-----
15520|hp|hbo        --------------------ENAVDAETYIELPL-------EFDNVRDRIRFGVE-----
1660|hp|hvo         --------------------ENTVEAETFVELPL-------QFQNVKDRIRFGVE-----
                                        :.   *  :: **:        :     . *:*       

11030|gene|hma      AAFPLLHTFSSLIAGLVLTG-VLAAHLAMIPSRRDAVTALAVVAGFWVYMWGYYRFAEQS
1389|chp|nrc1       ---------GALSEGVVADGDELGCVAPFLSEEVDMVTRTRANAGTQSSVYELFASTRAE
301|hp|hut          ---------GALEKEYVMETDDILCLGRTYADELDTIVRVRAGEFVESGVYDLFVNSRAE
1713|hp|hhi         ---------GALEQGIVDEGDEVLCVTEVLDGAENTLVRVQTNDFSPSGVYDMFVNSRAD
1442|gene|hla       ---------GAMDAELVSEGDEVVCIASVFDGGSDAVIRVTVDETVHTGIYDLFVNSRAE
2563|hp|hwa         ---------GAIESGIVAEGDAVVCNLSIFDDGPDSLVRVQVGESIRSGIYDLFVNSRAD
4194|hp|nph         ---------GGLEHEFVAEGDQVACAVALFDDDIDTVTRVRAGDFDQSGVYDLFVNSRAE
15520|hp|hbo        ---------GAMENGVVEEDDIVACNVAVFGGDQDAVIRVRVTEEMRSGIYDLFANSRAD
1660|hp|hvo         ---------GAMEQSIVEAGDTIACNVGTFGGDPDSLVRVRVEENMRSGIYDLFANSRAD
                             ..:    *     : .         : :    .       ::  :  :  .

11030|gene|hma      QLVVPYVDRISAYPGLFLAWVVVLVATLVWFQRTSARLQRVTVGGAVGLWFLTLGANALQ
1389|chp|nrc1       PGVIRDVFDVAIELG-----------------------RKGQKGKPVGALFVVGDAGKVM
301|hp|hut          PGVIRNVLEVAVELG-----------------------KKGQKGKPVGALFVVGDAGKVM
1713|hp|hhi         ASVVRDVFEVAIELG-----------------------KKGQKGKPVGALFVVGDAGKVM
1442|gene|hla       PSVIRDVFEVAIELG-----------------------QKGQKGKPVGALFVVGDAGKVM
2563|hp|hwa         SSVIRDVFNVAIELG-----------------------KKGQKGKPVGALFVVGDAGKVM
4194|hp|nph         PEVIRNVFEVAIELG-----------------------KKGQKGKRVGALFVVGDAGKVM
15520|hp|hbo        PSVIRNVFEVAIELG-----------------------KKGQKGKPVGALFVVGDAGKVM
1660|hp|hvo         PGVIRDVFEVAIELG-----------------------KKGQKGEPVGALFIVGDAGKVM
                      *:  *  ::   *                       ..   *  **  *:. .*. : 

11030|gene|hma      TVFPGTQTTPTGLLVLVAAFAVPVVFAVVGLPRASRDRRLVGPVMLALLLAPIVIVYFSL
1389|chp|nrc1       TKSRPLSYNPF-----------------------EKSHVHVGDPIVNVMLKEF-------
301|hp|hut          NKSRPLSYNPF-----------------------EKSHVHVGDPIVNVMLKEF-------
1713|hp|hhi         NKSRPLSYNPF-----------------------EKSHVHVGDPIVNVMLKEF-------
1442|gene|hla       NKSRPLSYNPF-----------------------EKSHVHVGDPIVNVMLKEF-------
2563|hp|hwa         NKSRPLSYNPF-----------------------EKSHVHVGDPIVKVMLKEF-------
4194|hp|nph         NKSRPLSYNPF-----------------------EKSHVHVGDPIVDVMLKEF-------
15520|hp|hbo        NKSRPLSYNPF-----------------------EKSHVHVGDPIVNVMLKEF-------
1660|hp|hvo         NKSRPLSYNPF-----------------------EKSHVYVGDPIVNVMLKEF-------
                    .     . .*                        ....  **  :: ::*  :       

11030|gene|hma      TASLTPEYYGTALRGQTFVHLPVFVLAGIGIASVAYRR-SPSPDGGLGSPKAHSHRLATV
1389|chp|nrc1       ----------SRLDGA-------FVISDSGKIVSSYRYLEPGAEG---------------
301|hp|hut          ----------SRLDGA-------FVISDSGKIVSAYRYLEPSAEG---------------
1713|hp|hhi         ----------SRLDGA-------FVISDAGKIVSAYRYLEPSAEG---------------
1442|gene|hla       ----------SRLDGA-------FVVSDSGKIVSAYRYLEPGAEG---------------
2563|hp|hwa         ----------SRLDGA-------FIVSDSGKIVSAYRYLEPGAEG---------------
4194|hp|nph         ----------SRLDGA-------FVISDSGKIVSAYRYLEPSAEG---------------
15520|hp|hbo        ----------SRLDGA-------FIISDSGKIVSAYRYLEPAAEG---------------
1660|hp|hvo         ----------SRLDGA-------FVISDSGKIVSAYRYLEPSAEG---------------
                              : * *        *:::. *    :**  .*..:*               

11030|gene|hma      LTIVVVVAAVVTMPIAFVNLDTLAFPTGATESQFAAATFTADHVDEQWASDHPFSRIVDL
1389|chp|nrc1       ----------------------TDIPKGLGARHMAAGAITRD------------------
301|hp|hut          ----------------------VDIPKGLGARHMAAGAVTRD------------------
1713|hp|hhi         ----------------------VDIPKGLGARHMAAGAVTRD------------------
1442|gene|hla       ----------------------VDIPKGLGARHMAGGAITRD------------------
2563|hp|hwa         ----------------------VDIPKGLGARHMAGAAITRE------------------
4194|hp|nph         ----------------------VDIPKGLGARHMAAGAITRD------------------
15520|hp|hbo        ----------------------VDIPKGLGARHMAGAAITRD------------------
1660|hp|hvo         ----------------------VDIPKGLGARHMAGGAITRD------------------
                                            :*.*    ::*..:.* :                  

11030|gene|hma      YYPGSTNGTYQPTARWLGGGMEPSCPTLSRASWGTTGAHLFPAGSEKTTPAALGEWRYEN
1389|chp|nrc1       ---------------------------------------------TNAVAIVLSE---SD
301|hp|hut          ---------------------------------------------TNATAIVLSE---SD
1713|hp|hhi         ---------------------------------------------TMATAIVLSE---SD
1442|gene|hla       ---------------------------------------------TNATAIVLSE---SD
2563|hp|hwa         ---------------------------------------------TNSTTIVLSE---SD
4194|hp|nph         ---------------------------------------------TNAVAVVLSE---SD
15520|hp|hbo        ---------------------------------------------TNATTIVLSE---SD
1660|hp|hvo         ---------------------------------------------TNATAIVLSE---SD
                                                                   :.. .*.*   .:

11030|gene|hma      DVVYDTRGLDSVYLVRPGGNRTNC
1389|chp|nrc1       GLVRAFRNGELVLELDPEDN----
301|hp|hut          GLVRAFKGGELILELDPEEY----
1713|hp|hhi         GLVRAFKGGELVLEIDPEEY----
1442|gene|hla       GLVRAFKAGELVLEIDPEEY----
2563|hp|hwa         GLVRAFKSGELIFEVDPEVY----
4194|hp|nph         GLVRAFSGGEIILELDPEEY----
15520|hp|hbo        GLVRAFKGGQMILEIDPEDY----
1660|hp|hvo         GLVRAFKGGKMILEIDPEAY----
                    .:*      . :  : *