HOG COG KOG arCOG COG description NRC-1 annotation
tucHOG0466arCOG04690hypothetical protein

HOG Organism Gene ID Name Annotation
tucHOG0466 nrc1 VNG2643 vng2643 no entry
tucHOG0466 hmu HMUK0615 Hmuk_0615 conserved hypothetical protein
tucHOG0466 hma RRNAC2082 dhp hypothetical protein
tucHOG0466 hwa HQ3109A hypothetical protein
tucHOG0466 hla HLAC0045 Hlac_45 hypothetical protein
tucHOG0466 hbo HBOR27910 Hbor_27910 hypothetical protein
tucHOG0466 hut HUTA0145 Huta_0145 conserved hypothetical protein
tucHOG0466 hvo HVO_0400 HVO_0400 conserved hypothetical protein
tucHOG0466 nph NP0430A hypothetical protein
tucHOG0466 hhi 2575 HAH_2575 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


3109|hp|hwa       MKEYKMRRGETLADRIPEMKTTIESYFGSITDTESYNGSDLYVVDDPDNPVFQRIVAGGV
27910|hp|hbo      MKEYKMRRGETLDDRVPDMESYVEEMFGTITGTEEYKGSDLYVVGEPSNPVFERIIAGAV
430|hp|nph        MEEYKMRRGEYLEERVPDMEATIEEYFGPITGTEEYKGNDLHVVADPDNPVFNRVVAGTM
145|chp|hut       -----MRRGEYLEDRIPDMRETVEEYFGPIAGTEPYNDTELFIVEEPDNPVFERVTVGTV
12082|hp|hma      MREYKMRRGEHLEDRVPDMEAFVEEYFGEVTDTEDYEGNDLLVVDDPDNPVFDRVVAGRV
2575|hp|hhi       MREYKMRRGEHLEDRVPDMEAFVEEYFGEVTDTEEYEGNDLLVVDDPDNPVFDRVVAGRV
2643|hp|nrc1      MKEYKMRRGEYLDERVSDMLATVEEYFGDVTDTKRFKDSDLYVVEDPDNPVFKRIVAGTV
45|hp|hla         -----MRRGEHLDDRMPDLKGSIEEYFGEVTDTEEWQDHELYVVEDPDNPVFDRIVAGAT
                       ***** * :*:.::   :*. ** ::.*: ::. :* :* :*.****.*: .*  

3109|hp|hwa       SYSNKKDTIAVDFVECDPSE-LDPDDLAAAGDAVDIKNTFLKEATGRDAKSRRESMKRAV
27910|hp|hbo      KYSGKKDKLAVEFTERDPTE-LGPDELEAAGEAVDAKNTFLLEATGRDAKSRRDSLKRSV
430|hp|nph        SYSSKKDKLAVDFDERELEELMETGDVDAAADANNAKNDFLLECTGRDAKARRESMKRAV
145|chp|hut       PYGSKKDKLALDIEERPAEEVIAEGHVEAAEDAVNVKNDFLEMATGRDAKARRDSMKRSV
12082|hp|hma      EYGSKKDKIALHIDERPAEDVIAEGNVDAAEDAVAIKNDFLEEATDRDAKARRDSLKRSV
2575|hp|hhi       EYGSKKDKIALHIDERPAEDVIAEGNVDAAEDAVAIKNDFLEEATDRDAKARRDSLKRSV
2643|hp|nrc1      EYAGKKDKLGVQFEERPAEDVIAEGNADAAADAVDAKNDFLLEATGRDAKSRRDSMKRSV
45|hp|hla         KYGSKKDKLAVHFEERPAEDVIAEGNADAAADAVDAKNEFLLEATGRDAKSRRESLKREV
                   *..***.:.: : *    : :  .   ** :*   ** **  .*.****:**:*:** *

3109|hp|hwa       EDDA--PDY-
27910|hp|hbo      EDDA--PDY-
430|hp|nph        EDDAETPDNV
145|chp|hut       EDDADKPDSV
12082|hp|hma      EDDADAPDNV
2575|hp|hhi       EDDADAPDNV
2643|hp|nrc1      EDDAEKPDTV
45|hp|hla         EDDA--PDY-
                  ****  **