HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0465COG4749arCOG04411hypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0465 nrc1 VNG1611 vng1611 no entry
cHOG0465 hmu HMUK1737 Hmuk_1737 conserved hypothetical protein
cHOG0465 hma RRNAC1735 hypothetical protein
cHOG0465 hwa HQ2867A hypothetical protein
cHOG0465 hla HLAC1933 Hlac_1933 hypothetical protein
cHOG0465 hbo HBOR08500 Hbor_08500 uncharacterized conserved protein
cHOG0465 hut HUTA2763 Huta_2763 conserved hypothetical protein
cHOG0465 hvo HVO_2417 HVO_2417 conserved protein
cHOG0465 nph NP4844A hypothetical protein
cHOG0465 hhi 2267 HAH_2267 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


4844|hp|nph        --MSTPPGEYYTAERWNNWLDRLREEEIDPESDDSARLFFNLLDDATIAIAKVITDYEDG
1611|chp|nrc1      --MSAPEEEFYSEERWQNWLDRLREEELDPEDEDSARLLLNLQDDVAIAAAKILNAYDSE
1933|hp|hla        MTDDDAVETFYTDERWQNWLDRLEEEDLDPENEDSARLLLNLQDDAAIAVVKVLAALDDE
2867|hp|hwa        --MTEAEETYYTEERWQNWLSRVEEEELDPENEDSARLLLNLQDDAAIAIAKIVSAFEED
8500|hp|hbo        --MTDAEETYYTKDRWQNWLTRVEEEELDPENEDSARLLLNLQDDAAIAVAKIVSAYEED
11735|hp|hma       --MSTPPGEYYTEERWQNWLDRIEEEDVDPEDEDSARLLLNLQDDAAIAVAKILTDYEDG
2267|hp|hhi        --MSTPPGEYYTEERWQNWLDRIEEEEVDPEDEDSARLLLNLQDDAAIAVAKILTDYEDG
2763|chp|hut       --MSAPPGEYYTEERWQNWIQRIESEDIDPEQEDSARLLLNLQDDTAIAVAKIVTDYEDG
                        .   :*: :**:**: *: .*::***.:*****::** **.:** .*::   :. 

4844|hp|nph        EFEDAEAAAAEIDNIRAIVLEEVDI---D----DEEKLTLVDGIQTSLVCALYAAEEYIV
1611|chp|nrc1      AVSE-SEAVDELADIRDVVLAEPAF---D----DEDKLMLVDGVQTSLVAVFYSAEQYVA
1933|hp|hla        RIDE-DRAVEEIRTVRDIVLADVEF---D----DEDKVMLIDGVQTSLVPVFYAAEEYVV
2867|hp|hwa        DLDQ-SVALDELERVREIVLAEPEF---DAQGGSEDKIMLVDGVQTSLICVFYAAEEYIL
8500|hp|hbo        TLSE-EDALDELEGVRDIVLSEPTFEGDD----VEEKVMLIDGVQTSLVCVFYAAEEYIV
11735|hp|hma       PLDE-EATLDELTGVREIVLDDIDI---D----DEETVMLIDGVQTSLLCVFYAAEEFVA
2267|hp|hhi        PLDE-EATIDELTGVREIVLDDIDI---D----DEETVMLIDGVQTSLLCVFYAAEEFVA
2763|chp|hut       ELEA-EAALEELQGVREIVLEEVDI---A----DEEKLMVVDGVQTSLVCVFFAAEEYVA
                    ..  . :  *:  :* :** :  :         *:.: ::**:****: .:::**::: 

4844|hp|nph        GGPAEEGTIEQYIDAAAAAEAEEEDLDTALAHCVQAGTLVIEGD-DIGLDVAEDIEYGFV
1611|chp|nrc1      DGVADDAPVMEYVRAAVEAEA-EEDLDRALGLVAAGGTRVIDGD-ELDMAVLEEVEYGLV
1933|hp|hla        GGVV-EGDVSEFVHAAADAEA-NDDLDAALGYVVQAGTRIIDGE-ALDIDLVEELEYGLV
2867|hp|hwa        GGTAESAPLTEYVEAAADAEA-DEDVDAALGYLVQAGTRIIAGD-ELDVTVVDEIEYGLV
8500|hp|hbo        AGPAEAAPLEEYVTAAAEAEQ-EENMDAALGYLVQAGTRIIEGD-ELDMSIAEELEYGLV
11735|hp|hma       EGAADDATITDYIEAAADAEA-EEDLDAALGYCVQAGTQIIGGS-ELPMEVAEDLEYGLV
2267|hp|hhi        EGPADDATITDYIEAAADAEA-EEDLDAALGYCVQAGTQIIGGS-ELPMEVAEDLEYGLV
2763|chp|hut       GGVA-EAPIADLIAAASEAES-EENMDAALGYCAQAGTRIIADEAELPRDVVDDLEFGLV
                    * .  . : : : **  **  ::::* **.  . .** :* ..  :   : :::*:*:*

4844|hp|nph        ADWVNGLDSLGRALSDPELVEEE----
1611|chp|nrc1      TEWVNGLDSLQSALSDPEVIEDEESGE
1933|hp|hla        SEWVNGLDSLQSAIEDPEVVEEEG---
2867|hp|hwa        SEWVNGLDSLQSAMSDPEVVEED----
8500|hp|hbo        SEWLNGLDSLQSAMSDPEVVEEDEE--
11735|hp|hma       SEWVNGLDSLQTAMSDPEVVEEDES--
2267|hp|hhi        SEWVNGLDSLQTAMSDPEVVEEDES--
2763|chp|hut       AEWVNGLDSLQTAMSDPEVVEEDDE--
                   ::*:******  *:.***::*::