HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0463COG1060Thiamine biosynthesis enzyme ThiH and related uncharacterized enzymeshypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0463 nrc1 VNG1937 vng1937 no entry
cHOG0463 hmu HMUK1415 Hmuk_1415 Radical SAM domain protein
cHOG0463 hma RRNAC3279 cofG FO synthase subunit 1
cHOG0463 hwa HQ3125A cofG FO synthase subunit 1
cHOG0463 hla HLAC1894 Hlac_1894 Radical SAM domain protein
cHOG0463 hbo HBOR06390 Hbor_06390 FO synthase subunit 1
cHOG0463 hut HUTA1304 Huta_1304 Radical SAM domain protein
cHOG0463 hvo HVO_2201 HVO_2201 radical SAM domain protein protein
cHOG0463 nph NP2398A cofG FO synthase subunit 1
cHOG0463 hhi 520 cofG FO synthase subunit 1
MUSCLE (3.6) multiple sequence alignment


1304|gene|hut       --MIRNPDVIPGAEEYDVDVTIDPAERERLLSVGPEDVAGPGEDGGPDHLSFARNVFIPL
2398|gene|nph       ---------MFGAADYGVDIQVDDGDTERLLSVTPDDVS------AAESLSFCRNVFVPL
1937|chp|nrc1       MWGCAVTETQFGGDEYDVSVSVSEAAVERALDVRPADVA------PASSLTFARNVFVPL
13279|gene|hma      ---------------------------------MPEDVE------AASALSYCRNVFLPL
520|gene|hhi        --------MIPGTDAHDIDIEIPDADIERLLSVMPGDVE------AASALSYCRNVFLPL
1894|gene|hla       --------MFAAAEEYGIEIEPDPERVERLLSITPADVE------PADRLTFARNVFVPL
6390|gene|hbo       --------MFPAADEYDVRITPDDDAVERLLAVTPDDVS------PASELTFSRNVFLPL
3125|gene|hwa       --------MFPAAAEYDIDFTIPSTSINRLLSATPADVN------SAAALTFSRNVFIPL
                                                      * **        .  *::.****:**

1304|gene|hut       TTACRYTCTYCTYYDPPGQASLLSPEDVREICREGADAGCTEALFTFGDDPDDRYDAIYD
2398|gene|nph       TTACRYTCTYCTYYEPPGQASLLSPAEIRDICERGADAGCTEALFTFGDDPDDRYERIHG
1937|chp|nrc1       TTACRYTCTYCTYYDVPGEASLLTPEEIREQCRVGADAGCTEALFTFGDQPDDRYTAIHE
13279|gene|hma      TTACRYTCTYCTYYDPPGQAELMDREEIRETCRRGADAGCTEALFTFGDDPDDRYTAVHD
520|gene|hhi        TTACRYTCTYCTYYDPPGQAELMDREEIRETCRRGADAGCTEALFTFGDDPDDRYTAVHD
1894|gene|hla       TTACRYTCTYCTYYDVPGEASLLSPEEVRQRCRVGADAGCTEALFTFGDEPDDRYTAVHD
6390|gene|hbo       TTACRYTCTYCTYYDVPGEATLMSPEDVRETLRVGADAGCTEALFTFGDEPDDRYTAIHE
3125|gene|hwa       TTACRYTCSYCTYYDIPGEAALLSPQEVRHRVQLGADAGCTEALFTFGDRPDDRYEAIHA
                    ********:*****: **:* *:   ::*     *************** *****  :: 

1304|gene|hut       QLAEWGHDSIHTYLREACEIALEEGLLPHANPGDQTREQMAEVADLNASMGVMLETTADL
2398|gene|nph       QLAEWGHDSIHDYLREACDIALDCGLLPHSNPGDQTREQMGRVADLNASVGVMLETTAEV
1937|chp|nrc1       QLGEWGYDSIHEYLRAACEIALEAGLLPHANPGDQTRAQMATVADVNASMGVMLETTADV
13279|gene|hma      QLAEWGHDSIHEYLREACEIALEEGLLPHANPGDQTREQMAHVADLNASMGVMLETTTEV
520|gene|hhi        QLAEWGHDSIHEYLREACEIALEEGLLPHANPGDQTREQMAHVADLNASMGVMLETTTEV
1894|gene|hla       QLDEWGYDSILEYLYRACEIALEEGLLPHSNPGDLTEAAFADLREVNASMGVMLETTADV
6390|gene|hbo       QLSEWGYDDILAYLRDCCEMAMEEGLLAHSNPGDLTESAFERLAPVNASMGVMLETTADV
3125|gene|hwa       QLDVWGFDDIIEYLNMCCHIALEEGLLPHSNPGDLTLTEFEQLAPVNASMGVMLETTADV
                    **  **.*.*  **  .* :*:: ***.*:**** *   :  :  :***:*******:::

1304|gene|hut       EAHSGSRRKEPGQRLATIRTAGELGVPFTTGILVGIGEDWADRAESLLAIAALHERYNHV
2398|gene|nph       RAHGGPRAKEPGQRLATIATAGELGVPFTTGILVGIGETARDRAESILAIRELHERYGHI
1937|chp|nrc1       QAHGGPRAKSPEQRLHTIDVAGDLGVPFTTGILVGIGEDWRDRAESLLAIRALHERHDHV
13279|gene|hma      QAHGGPRAKNPGQRLNTLRVAGELGVPFTTGILVGIGEDWHHRAESLLAIREMHERYGHI
520|gene|hhi        QAHGGPRAKNPGQRLNTLRVAGELGVPFTTGILVGIGEDWHHRAESLLAIRELHERYDHI
1894|gene|hla       DAHSGGRRKTPGQRLNTIRAAGRQGVPFTTGILLGIGEDWRDRAESLLAIREIHERHGHV
6390|gene|hbo       RAHSGGRRKTPGQRLNTIRAAGKVGVPFTTGLLIGIGETWRDRAESLLAIRELHERYDHI
3125|gene|hwa       DAHAGTRRKTPGQRLNTIRAAGKAGIPFTTGLLVGIGEEWRDRAESLLAIRELHERYDHI
                     **.* * * * *** *: .**  *:*****:*:****    ****:***  :***:.*:

1304|gene|hut       QEVIVQPVSPNERWDREPPSLETMRRTVAMARAGLPETVSVQVPPNLARTRDLLDCGVDD
2398|gene|nph       QEIIVQPVSNNDRWQQGSPELETLRRATAMARAGLPAEISVQSPPNLAPVRELLDCGVDD
1937|chp|nrc1       QEVIVQPVRPNARWQGEPPGAETMRRVVAMARAVLPAEVGVQVPPNLTDVRGLVDCGVDD
13279|gene|hma      QEVIIQPVVENERWQGGSPDLATMRRVTAMARAALPEEVSVQVPPNLAPARDLTDCGIDD
520|gene|hhi        QEVIVQPVVENERWQGGSPDLATMRRVTAMARAALPEEVSVQVPPNLAPARDLTDCGIDD
1894|gene|hla       QEVIVQNVVPNERSDFEKPDLATMRRVVAMARAALPPEVSVQVPPNLSPAADLVDCGIDD
6390|gene|hbo       QEVIIQNVVPNERSSFDQPSVETMRRAVAMARVALPDEVSVQVPPNLSPTRELLDCGVDD
3125|gene|hwa       QEVIIQNVVPNERSDFEQPSVSTMRRVVAMARVCLPKSISVQVPPNLSPTRELLDCGVDD
                    **:*:* *  * * .   *   *:**..****. **  :.** ****: .  * ***:**

1304|gene|hut       LGGVSPVTDDHVNPDYAWPALDELRAIADDAGVPLRERLPVYDRYV--------------
2398|gene|nph       LGGVSPVTDDHVNPDYAWPALRELENIAEEAGVPLEERLPVQDRYA--------------
1937|chp|nrc1       LGGVSPVTKDHINPDYAWPALDELSAIADHAGVPLRERLPVYERFLPA-------DGGTA
13279|gene|hma      LGGVSPVTVDHINPEYEWPALQELTAVAEAAEVPLSERLPVYDHFV--------------
520|gene|hhi        LGGVSPVTVDHINPEYEWPALQELTAVADAAEVPLTERLPVYDRFV--------------
1894|gene|hla       LGGVSPVTDDYVNPDYAWPDLDGLRTVADAGGMPLRERLPTYARFLPDGLRPSDTEPAAP
6390|gene|hbo       LGGVSPVTDDYVNPDYKWPALQELRDIADKGDVPLYERLPVYERYLPERYRRDDFDGVET
3125|gene|hwa       LGGVSPVTEDYINPDYAWPALSELTDIASSAGVPLHERLPVYDRYLPKQIRREGFTGHSA
                    ******** *::**:* ** *  *  :*. . :** ****.  .:               

1304|gene|hut       DED---WLSEQVLATVSTVTSTDETGT----------------------
2398|gene|nph       ASE---WLSPRIQSAIEADSEAGRRYRRVLESV----------------
1937|chp|nrc1       DDG---WVSQRIWRAIE----DGDRYEAVRAE-----------------
13279|gene|hma      DDG---WLSAPIEAAIEADNDAGDRFRSILDRGVNPVTL----------
520|gene|hhi        DDG---WLSEPIEAAIEAEDDDGERFRSILDRGVNPASV----------
1894|gene|hla       PAGRDAWIPPAVRDRMRADDPHGRRLRGVARGDGPLAV--------RGD
6390|gene|hbo       DRE---WLSDRVRAAIDADNVHGKRYRGVARRDGPLTVG-------SAD
3125|gene|hwa       DGG---WLAEYITDAIESDGVHGQRYRSVACRDGPLNTNHSISAGESAD
                          *:.  :   :      .