HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0462COG0518KOG3179arCOG00087GMP synthase - Glutamine amidotransferase domainGMP synthase subunit A

HOG Organism Gene ID Name Annotation
cHOG0462 nrc1 VNG0228 guaAa GMP synthase subunit A
cHOG0462 hmu HMUK0029 Hmuk_0029 GMP synthase, small subunit( EC:6.3.5.2 )
cHOG0462 hma RRNAC1694 guaA2 GMP synthase subunit A
cHOG0462 hwa HQ1289A guaAa GMP synthase subunit A
cHOG0462 hla HLAC0571 Hlac_571 GMP synthase, small subunit
cHOG0462 hbo HBOR25620 Hbor_25620 GMP synthase, glutamine-hydrolyzing, N-terminal domain or A subunit( EC:6.3.5.2 )
cHOG0462 hut HUTA2424 Huta_2424 GMP synthase, small subunit
cHOG0462 hvo HVO_0647 HVO_0647 guaA GMP synthase N-terminal domain
cHOG0462 nph NP0620A guaAa_1 GMP synthase subunit A
cHOG0462 hhi 2229 guaA3 GMP synthase subunit A
MUSCLE (3.6) multiple sequence alignment


228|gene|nrc1       MTHILVVDNHGQFTHLEHRLLRDMDGVTVDLTDNTTPPADI--DADGLVLSGGPTMADIG
1289|gene|hwa       MTHIAVIDNHGQFTHLEQRALRDL-GVDVELVDNTTSPEQLIQTADGLVLSGGPDIDRVG
571|gene|hla        MTRIVVIDLHGQFTHLERRALRDV-GVDTEIVSADTPPAEI--DADGIVLSGGPDMDRVG
2424|gene|hut       MTRIDVIDNHGQFTHLEQRALRDL-GVDVSLVDNTTPPAEI--DADGLVLSGGPSMDRIG
11694|gene|hma      MTRIDVIDNHGQFTHLEQRALRDM-GVDVSLRDNTTPPEEI--DADGIVLSGGPDMDDIG
2229|gene|hhi       MTRIDVIDNHGQFTHLEQRALRDM-GVDVSLRDNTTPPEEI--DADGIVLSGGPDMDDIG
25620|gene|hbo      MTRIVVIDNHGQFTHLEHRALRDL-GIDTELVDNDTPPEEI--DADGIVLSGGPDMDRIG
620|gene|nph        MTRIVVVDNHGQFTHLEHRALRDL-GVDTELIDNDTPPEEI--DADGIVLSGGPDMDRIG
                    **.* *:* ********.* ***: *: ..: .  *.* ::   ***:****** :  :*

228|gene|nrc1       HCREYLTLDVPILGVCLGHQLIADELGGRIEAGDYGGYADVTVSISDADDPLVGSLAPDT
1289|gene|hwa       NCPEYLELDIPILGICLGMQLLANELGGSVAAGDYGGYADVDIEILDDTDPLIGSLAPET
571|gene|hla        NAPDYLDLDVPVLGICLGMQLIAVERGGAVGGGDYGGYADVDVEIVDDEDPLVGSLAPKT
2424|gene|hut       NSPAYLDLDVPVLGICLGMQIMAAELDGAVGEGDYGGYADVTVDILDDADPLIGSLAPET
11694|gene|hma      NCPEYLDLDVPVLGICLGMQLIADELGGRVGGGEYGGYADVTVDILDDDDPLLGSLYPET
2229|gene|hhi       NCPEYLDLDVPVLGICLGMQLIADELGGRVGGGEYGGYADVTVDILDDDDPLLGSLYPET
25620|gene|hbo      NCPDYLELDVPVLGICLGMQIIASELGGRVGSGEYGGYADVTVGVLDESDPLIGSLAPET
620|gene|nph        HSPAYLDLDIPVLGICLGMQLMAAELGGRVGAGDYGGYADVTVSIEDESDPLIGSLAPET
                    :.  ** **:*:**:*** *::* * .* :  *:******* : : *  ***:*** *.*

228|gene|nrc1       RVWASHADEVVAVPDGFTITAESDICGVEAMGDTDRDLYGVQWHPEVAHTEEGEAVFENF
1289|gene|hwa       RVWASHADEVKSVPEGFERTARSDVCRIEAMSNRDQERYGVQWHPEVAHTERGEEVFKNF
571|gene|hla        RVWASHADEVVEVPEGFVRTATSDVCDVEAMSNTEAGLYGVQWHPEVAHTERGEEVFENF
2424|gene|hut       RVWASHADEVTQVPTGFERTATSDVCGVEAMSDTDRDLYGVQWHPEVAHTEEGEAVFENF
11694|gene|hma      RVWASHADEVKEVPPGFERTATSDVCGVEAMSNTDEAIYGVQWHPEVAHTEEGEEVFENF
2229|gene|hhi       RVWASHADEVKEVPPGFERTATSDVCGVEAMSNTDEAIYGVQWHPEVAHTEEGEEVFENF
25620|gene|hbo      RVWASHADEVKEVPAGFTHTGSSDVCSIEAMSDPDRDLYGVQWHPEVAHTENGEEVFENF
620|gene|nph        RVWASHADEVKELPDGFERTATSEVCNIEAMSDTDRNRYGVQWHPEVAHTEAGEEVFENF
                    **********  :* **  *. *::* :***.: :   ************* ** **:**

228|gene|nrc1       VAICE-------
1289|gene|hwa       IARCQ-------
571|gene|hla        VAICESA-----
2424|gene|hut       LSICE-------
11694|gene|hma      LSVCDQQSVARQ
2229|gene|hhi       LSVCDQQSVARQ
25620|gene|hbo      LDICNA------
620|gene|nph        RDICAGD-----
                       *