HOG COG KOG arCOG COG description NRC-1 annotation
tucHOG0461arCOG09230hypothetical protein

HOG Organism Gene ID Name Annotation
tucHOG0461 nrc1 VNG0597 vng597 no entry
tucHOG0461 hmu HMUK2320 Hmuk_2320 conserved hypothetical protein
tucHOG0461 hma RRNAC0849 hypothetical protein
tucHOG0461 hwa HQ2497A glycine-rich protein
tucHOG0461 hla HLAC2361 Hlac_2361 glycine-rich protein
tucHOG0461 hbo HBOR20710 Hbor_20710 hypothetical protein
tucHOG0461 hut HUTA0399 Huta_0399 conserved hypothetical protein
tucHOG0461 hvo HVO_1170 HVO_1170 conserved hypothetical protein
tucHOG0461 nph NP4404A hypothetical protein
tucHOG0461 hhi 1488 HAH_1488 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


2497|gene|hwa      MADDSEESVDTDPETNHETESGDDTADNASADTADADE-DEKSFRERVEEIRQRRAEERE
2361|gene|hla      MADD-------DPTNADDGEEQGDSAAGAEGGDAEGDDGEEKSFRERVEEIRERREQERE
20710|hp|hbo       MPED-------PDEPTDESAE--DAGEPTEGAGADGDD-EEKSFRERVEEIRKRREEERE
597|hp|nrc1        MADD--------DQPADDAAE---------------DDGEEKSFRERVEEIREERAEERD
399|chp|hut        MTDE--------PEDTEESDA------------EPGD--EEQSFRERVEEIRQERAEE--
4404|hp|nph        MTDE-----------------------------EEGESGEEKSFRERVEEIRQQRAEEGD
10849|hp|hma       MADD-------EPEDAGESAD------------ATEEGGEEKSFRERVEEIRQQRAEERE
1488|hp|hhi        MADD-------EPENADESAD------------ATEDGGEEKSFRERVEEIRQQRAEERE
                   *.::                                :  :*:**********: * :*  

2497|gene|hwa      SGE--------RPEPDEMMGGGGGGPGGAPGGMGGMGGGGGGGGGGGNPFAQMMSGMMGG
2361|gene|hla      EGD--------RPDPEEMMGGGGG-----PPGM------GGGG--GGNPFAQMMSGMMGG
20710|hp|hbo       EGE--------RPSPEEMMGGGGG-----PG--------------GGNPFAQMMSGMMGG
597|hp|nrc1        EGDGE----DPRERMADAMGGGGG-----PPGM------GGGGGGGGNPFAQMMGGMMGG
399|chp|hut        -GGEDMDMEDRRERMEESMG--GG-----PGGM------G-----GGNPFAQMMSGMMGG
4404|hp|nph        -GEGDGEGLSREEKMQEMMGGGGG-----PGGM------GGGGGMGGSPFAQMMGGMMGG
10849|hp|hma       EGEGDGEEMSREERMEEMMGGGGG-----PGGM------G-----GGNPFAQMMGGMMGG
1488|hp|hhi        EGEGDGKEMSREERMEEMMGGGGG-----PGGM------G-----GGNPFAQMMGGMMGG
                    *              : **  **     *               **.******.*****

2497|gene|hwa      GGPG------AGAGAGGPGMGD------GDDSDNEEVVREIRQLRDEVRDATRQLQRIAQ
2361|gene|hla      GGPG-GAGGPPGMGGGGPGGAGGRGEERGDQAGNEELVREVRQLRDEVRDATRQLQRIAQ
20710|hp|hbo       GGPG-MGGGMGGGPGGPPGAAGGRGE--SESAGNEELVREVRQLRDEVRDATRQLQRIAQ
597|hp|nrc1        GGGG-----PPGMGGGPGGD--------ESGGTSETAERELEMLRKELERTNNKLDRIAN
399|chp|hut        GPGG--PGGPGGRGPGQMGPEGE-----GEEDSNEEITREVRKLRDEVHDVRRELERIAD
4404|hp|nph        GGPGAGAGGPPGMGGSPEGE----------GSDNEELVREVRKVRDELHDIRREMERVAD
10849|hp|hma       GPGGPGPGGPGGMGGGPPGQREE-----SGGSDNEELTREMRKLRDEVHDMRRSLDRIAD
1488|hp|hhi        GPGGPGPGGPGGMGGGPPGQHEE-----SGGNDNEELTREMRKLRDEVHDMRRSLDRIAD
                   *  *       *   .  *              .*   **:  :*.*:    ..::*:*:

2497|gene|hwa      AVEDLTDN
2361|gene|hla      ALEDD---
20710|hp|hbo       AVEDLDD-
597|hp|nrc1        ALED----
399|chp|hut        ALED----
4404|hp|nph        ALEER---
10849|hp|hma       ALED----
1488|hp|hhi        ALED----
                   *:*: