HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0459COG3030arCOG03059Protein affecting phage T7 exclusion by the F plasmidhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0459 nrc1 VNG1906 vng1906 no entry
cHOG0459 hmu HMUK1580 Hmuk_1580 FxsA cytoplasmic membrane protein
cHOG0459 hma RRNAC3314 fxsA FxsA
cHOG0459 hwa HQ3315A fxsA FxsA
cHOG0459 hla HLAC1365 Hlac_1365 FxsA cytoplasmic membrane protein
cHOG0459 hbo HBOR07640 Hbor_07640 protein affecting phage T7 exclusion by the F plasmid
cHOG0459 hut HUTA2261 Huta_2261 FxsA cytoplasmic membrane protein
cHOG0459 hvo HVO_2351 HVO_2351 fxsA similar to FxsA protein
cHOG0459 nph NP1962A fxsA FxsA
cHOG0459 hhi 552 fxsA inner membrane protein FxsA
MUSCLE (3.6) multiple sequence alignment


1962|gene|nph       ----------MRLRVIGLLLLVPVVDILLLVVLATRLGPVTIGPVATVAVVVLTALLGLL
1906|hp|nrc1        --------MPRFRSVFLALLVVPLVDAVFLVFVAGE-----LGWQLTVALVVLTALLGTL
1365|gene|hla       MGPRRKDDGMRPRTLLALLLVVPLVDALFLIVVATR-----LGWAITVALVVLTAVLGML
2261|gene|hut       -----------MLRIIALLLLIPLVDMVMLVVVAGK-----LGAVPTVLLVVLTGLIGML
13314|gene|hma      -----------MLRVIGLLLLIPLFDIVLLVTVAIPF----LGSLVTVALVVLTALVGML
552|gene|hhi        -----------MLRVIGLLLLIPLFDIVLLVTVAIPF----LGSLVTVALVVLTALVGML
3315|gene|hwa       ---------MKARWVIVGLLSIPLVDTLLLVPIATA-----IGLLTTVLIVVLTGLFGMV
7640|gene|hbo       ---------MQTRWVIAALLSIPLLDTLLLVPLAST-----IGFAPTVLLVVLTGLVGML
                                  ::  ** :*:.* ::*: :*       :*   ** :****.:.* :

1962|gene|nph       FARAEGRHTLRKIQRKLANGDAPTNELLDGLLLIIAGTLMLTPGVITDFIGLLLVLPPTR
1906|hp|nrc1        FVRAEGRATLSRLQASVARGDPPTNELVDGGLLIAAGAFLLTPGLVTDALGFLIVIPVTR
1365|gene|hla       LLRAEGRATLARVQRKLARGEPPTDELLDGGLLIAAGAFLLTPGLVTDAVGFLLALPLSR
2261|gene|hut       LVRAEGRHTIAKIQRKVLQGEAPTDELLDGALLLIAGALLLTPGLVTDVIGFVLVIPPTR
13314|gene|hma      LVRAEGRATLRKIQQRLAVGELPTDELIDGGLLIAAGAFFLTPGLVTDFVGLLLAVPFTR
552|gene|hhi        LVRAEGRATLRKIQQRLAVGELPTDELIDGGLLIAAGAFFLTPGLVTDFVGLLLAVPFTR
3315|gene|hwa       LVRAEGRTTIQRIQQKIARGTLPTNELIDGGLLIAAGAFLLTPGIVTDIIGFASAIPVTR
7640|gene|hbo       LVRAEGRHTLSKLQQKVATGGIPTDELLDGGLLIAAGAFLLTPGVVTDLLGFLLAIPVTR
                    : ***** *: .:*  :  *  **:**:** **: **:::****::** :*:  .:* :*

1962|gene|nph       YPIRIATKKYVVTPFLDDKTGGFASGNVYVGGFPG---GDE--TAGQGFPGGGGPGGGFP
1906|hp|nrc1        VAFRWGVKRY-VTPKLDAKTGGFVSGNVYTFGFPG---GDG-GAGGD----PRSGFGGGA
1365|gene|hla       VPIRMALKKYVVIPYLDSETNGFTTGNVYIGGFPGNGDGDG-NGAGAGFTMGGGFGGGNF
2261|gene|hut       YPVRLALKKWVVTPYLEKKTGGFATGSVYVGGFPN---DDGDGPVGGDSSGPGGFGGPGG
13314|gene|hma      YPVRAATRRWVVRPYIDAKTSGFASGQVYVGGFPN---DEN-GPAGPGATGPDGGPSSGS
552|gene|hhi        YPVRAATRRWVVRPYIDAKTSGFASGQVYVGGFPN---DEN-GPAGPGATGPDGGPSSGS
3315|gene|hwa       YPIRILTKRYIVTPILDRRTNDFISGNVYIDGFPD---EDT-------------------
7640|gene|hbo       YPIRKVVKRFVVRPYLEKQTDGFVSGNVWVGGFPD---EDV-------------------
                     ..*   ..: * * ::  *..* :*.*:  ***.    :                    

1962|gene|nph       GDASG-----------------PDAAGDTVEMGEADYEFTDPEPDEDDDTDSDRTA
1906|hp|nrc1        GDGDD----------------------DTINLGDDAYDVSF---EDDADGDQ----
1365|gene|hla       GNGDGFGSDDEVAGGNSPGDDSDGDRFDDADHADDVVDVDFTVEDEETDRSD----
2261|gene|hut       IGGIG--------GIGGSTDDGVRDIGEAQDLDDV---------EDGDDRPE----
13314|gene|hma      GSGSG-------------------TSFDPTEATDVDFD------DSDEN-------
552|gene|hhi        GSGSG-------------------TSFDPTEATDVDFD------DSDEN-------
3315|gene|hwa       ------------------------VNLDPEEYGRP---------DEDR--------
7640|gene|hbo       ------------------------VNLDPENYGRA---------DDDNT-------
                                               :  :             :.