HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0458COG0484KOG0715 KOG0712arCOG04771DnaJ-class molecular chaperone with C-terminal Zn finger domainheat shock protein

HOG Organism Gene ID Name Annotation
cHOG0458 nrc1 VNG0489 dnaJ heat shock protein
cHOG0458 hmu HMUK2850 Hmuk_2850 chaperone protein DnaJ
cHOG0458 hma RRNAC3334 dnaJ2 chaperone protein DnaJ
cHOG0458 hwa HQ2641A dnaJ chaperone protein DnaJ
cHOG0458 hla HLAC0681 Hlac_681 chaperone protein DnaJ
cHOG0458 hbo HBOR16260 Hbor_16260 chaperone protein DnaJ
cHOG0458 hut HUTA0290 Huta_0290 chaperone protein DnaJ
cHOG0458 hvo HVO_1589 HVO_1589 dnaJ chaperone protein DnaJ
cHOG0458 nph NP0346A dnaJ chaperone
cHOG0458 hhi 1498 HAH_1498 hypothetical protein
cHOG0458 hhi 574 dnaJ1 chaperone protein DnaJ
cHOG0458 hhi 382 HAH_0382 hypothetical protein
cHOG0458 hhi 4197 HAH_4197 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


4197|hp|hhi         MDSNTARNVLDLPQNRYLDDDDIQKAFREKSKEYHPDTSDLPNARKKFLEVKKARKVLLA
1498|hp|hhi         ----------------------------------------------MLDKIKKSVSDVLS
382|hp|hhi          ------------------------------------------------------------
489|gene|nrc1       -MSEDFYDVLGVSRDA--TEDEIMQAYRDQVSEYHPDVSDDPDAEEKFKKIQKAKDVLTD
2641|gene|hwa       -MSEDFYDVLGVSRNA--DGDDIKQAYRKKAAKYHPDVSDDPNAEEKFKKIKKAKEVLTD
16260|gene|hbo      -MSEDFYDVLGVSRDA--SEDEIKQAYRKKAAQYHPDVSDEPDAEEKFKKVKKAKEVLTD
681|gene|hla        -MSDNFYDVLGVSRDA--SEEEIKKAYRKQAAEHHPDVSDDDDAEERFKAIQKAKEVLTD
346|gene|nph        -MSEDFYSVLGVSRDA--DEDEIKQAYRKKASEYHPDVSDDPNAEEKFKQVKKAKEVLLD
290|gene|hut        -MSEDFYDVLGVSRDA--SEEEIQEAYREKAREYHPDVSDDPDAEEKFKKAKKAKEVLTD
13334|gene|hma      -MSQDFYEILGVSRDA--SEDEIQEAYREKAREYHPDVSDDPDAEEKFKQAKKAKEVLTD
574|gene|hhi        -MSQDFYEILGVSRDA--SEDEIKEAYREKAREYHPDVSDDPDAEEKFKKAKKAKEVLTD
                                                                                

4197|hp|hhi         AETSKS------SQSNSSTTQGGNT-QSTSPTGNATDAHNSSP-------NSRSESRTES
1498|hp|hhi         GGKRQS------------------------------------------------------
382|hp|hhi          ------------------------------------------------------------
489|gene|nrc1       EETRQQYDQLGHERFEEAEKRGATGNGGGGAGGMG---GAGGPFGGGMG-GGAGGGMGDI
2641|gene|hwa       GEKRQMYDQLGHDRFQQAEKRGGVG-GGGNSSGGS---ARGDPFGGM---GGQGSPFGDI
16260|gene|hbo      EQKRRQYDQLGHDRFEQAEKRGGVG-GAGGMGG------RGNPFGGAG--GGQGNPFEDI
681|gene|hla        EQKRQQYDQLGHDRFTEADKRGATG-G-GGPGG-----AGG-PFGGAGGAGGAG-GFEDI
346|gene|nph        DEKRRMYDQMGHERFQEAEKRGATD-TDRGRGG-----MGG--MGG----GGMG-GMNDI
290|gene|hut        EEKRQAYDRMGHDRFEQAEKRGGFD-DRSGRGGAGGRRAGGDPFGG----GGFG-SVEDI
13334|gene|hma      EEKRQMYDQMGHERFEQAEKRGGAG-GGGGRGG-----MGGDPFGG----GAGGFDMQDI
574|gene|hhi        EEKRQMYDQMGHERFEQAEKRGGAG-GGGGRGG-----MGGDPFGG----GAGGFDMQDI
                                                                                

4197|hp|hhi         KSQATQSSWQNETHG--QTRNREVSNDWRTNRAGSSTGNQESASDKEQHQRKQTSSETKA
1498|hp|hhi         -----------------DSGPQA-GAVTEKRV---------------------KASSAGD
382|hp|hhi          ------------------------------------------------------------
489|gene|nrc1       FEQFFGGAGGGGGRG--RSGPEQ-GRDLRTDLTVTLSEAYRGVSKQVTVRRPESCADCGG
2641|gene|hwa       FEQFFGGGQGQRRQG---NRPRQ-GQNLQTRVQLDLEEVYTGVEKQFTVRRPEKCPDCNG
16260|gene|hbo      FSQFFGGGGGMGGQGQQRNRPRQ-GQNLRTRVSLDLEEAYEGVEKQFSVERPERCPECDG
681|gene|hla        FNQFFGGGGGRGGGG--GNRPRQ-GQDLRTGLTIDLEEAFEGATKEVTLTRPTQCDTCDG
346|gene|nph        FEQFF-GGGG-RSQS--RSGPRQ-GSDLKTRLKVDLEDAYHGVTKQLTVTRPEECPDCDG
290|gene|hut        FDQFF-GGGG-GGRG--RDRPRQ-GQDLKTRLSIGLDEAYEGVEKQFTVTRPETCSDCGG
13334|gene|hma      FDQFF-GGGGRGGRG--GSRRRQ-GQDLQTRLEIDLEEAYNGATKQLNVTRPEACDDCDG
574|gene|hhi        FDQFF-GGGGRGGRG--GSRRRQ-GQDLQTRLEIDLEEAYNGATKQLNVTRPEACDDCDG
                                                                                

4197|hp|hhi         ETESGEKTVDDRTKIHQQAWEEFTSWEPFYGFRGGGYLGVKAFPKRPPSRSRILHLFAVI
1498|hp|hhi         SG--------------------------------------TDAADGPESNLYE-------
382|hp|hhi          --------------------------------------MVQRTPPAEDQNRLV-------
489|gene|nrc1       SGYPEDADVRTCPQCDGQ----------------GVVTQVRQTPLGRVQQRQE-------
2641|gene|hwa       RGHPSDADVRTCPQCNGQ----------------GQTTTVRETALGRVQQTQT-------
16260|gene|hbo      DGHPADAEVHTCPQCNGQ----------------GQTTTVRDTPLGRVQQTQT-------
681|gene|hla        AGHPPDADVETCSQCNGR----------------GQVQQVQQTPLGRVQQTST-------
346|gene|nph        AGHPPDADSRTCSACDGR----------------GQQTTVRQTALGRVQQTRE-------
290|gene|hut        EGHPPDADSRTCPECEGR----------------GQVTRVQRTPMGRVQQTTT-------
13334|gene|hma      AGHPPGADSETCPECNGQ----------------GQTTQVQQTPMGRVQQRTT-------
574|gene|hhi        AGHPPGADSETCPECNGQ----------------GQTTQVQQTPMGRVQQRTT-------
                                                               .    ..          

4197|hp|hhi         VGCIATAFLSRGQYNALSDSTAASRVIEPDISLRLSFTIPSVLAITGTFRKIKVLWRFLR
1498|hp|hhi         --CPSCDSVFVAIDKETCSSCR--------------------------------------
382|hp|hhi          --CRKCDY-STGVLRPSCPECGGDMV----------------------------------
489|gene|nrc1       --CSRCGG-EGELHSETCSTCGGQGQTRERATLTVD--IPEGIRTGQTLR----------
2641|gene|hwa       --CPRCDG-SGEMYTQTCSTCNGDGVTRQEATLSVD--IPAGIRDGQTLR----------
16260|gene|hbo      --CRQCNG-EGQTYSERCSQCNGDGVVREEATLEVT--IPAGIRDGQTLR----------
681|gene|hla        --CPRCEG-SGELYSEDCADCGGDGVVREEATLSVE--IPAGIRSGQSLR----------
346|gene|nph        --CPQCDG-KGTIYSETCSTCRGDGQVRNETTLQVE--VPAGIRDGQTLR----------
290|gene|hut        --CSRCDG-DGTLYEETCSTCRGDGVVRNEATLSVD--VPAGIRDGQSLR----------
13334|gene|hma      --CRRCDG-EGTLYDETCSTCRGNGVVQNDASLEVE--IPSGIADGQTLR----------
574|gene|hhi        --CRRCDG-EGTLYDETCSTCRGNGVVQNDASLEVE--IPAGIANGQTLR----------
                      *              .                                          

4197|hp|hhi         LPRVFLSILGGVAAPITVQSVVTDLSVPTATLVAAAGSGGLMSVLAVSRYPNKDQDIPTV
1498|hp|hhi         ------------------------------------------------------------
382|hp|hhi          ------------------------------------------------------------
489|gene|nrc1       --------MDGEGAPGE----------------PGAPNGDLLVDVTVEEHPDFERDGDDL
2641|gene|hwa       --------MEREGAPGD----------------NGGPRGDLLIDVSVRDHPDFERDGDDL
16260|gene|hbo      --------MEREGAPGE----------------NGGPNGDLLIEVSIREHEDFERDGDDL
681|gene|hla        --------MEREGAPGE----------------NGGPNGDLLIEVDVDVGDRFERDGDDL
346|gene|nph        --------MDGEGAPGE----------------NGGRKGDLLVEIRIDDHETFERDGDDL
290|gene|hut        --------MEREGAPGE----------------HGGPNGDLLIEVEIEEHDDFERDGDNL
13334|gene|hma      --------MEREGAPGE----------------NGGPNGDLLIEVQVRDHPDFERDGDSL
574|gene|hhi        --------MEREGAPGE----------------HGGPNGDLLIEVSVRDHPDFERDGDDL
                                                                                

4197|hp|hhi         DEWLNISPTLTWLPGGVFFLLALHTPVYMASQSFHLLYYGSFKFYFVLIGPSLALAYTYT
1498|hp|hhi         ------------------------------------------------------------
382|hp|hhi          ------------------------------------------------------------
489|gene|nrc1       H--------------------------HRHAVSFPQAVFGAEIEVPTLDGAATF------
2641|gene|hwa       Y--------------------------YRLAISFPQAVFGSTVEVPTVNGETTL------
16260|gene|hbo      H--------------------------HRLAISFPQAVFGATVEVPTVNGTTEL------
681|gene|hla        R--------------------------VNEAVSFPQAVFGDTIEVETVDGSVEM------
346|gene|nph        R--------------------------CRHPISFPQAVFGDTVEVPTLDGAVEM------
290|gene|hut        H--------------------------YTAPITFPQAALGDTVEVPTFDGPVEV------
13334|gene|hma      Q--------------------------HQQAISFPQAVFGDTITVPTLDGEVEV------
574|gene|hhi        Q--------------------------HQQAISFPQAVFGDTITVPTLDGEVEV------
                                                                                

4197|hp|hhi         RLIGGREVPTGTTLVSMMVIGLVVHFPWFEPIMPGYLLSEGGYYAVSNG----IRPRG--
1498|hp|hhi         ------------------------------------------------------------
382|hp|hhi          ------------------------------------------------------------
489|gene|nrc1       ------DLDAGT--------------------------QSGETFRLKGKGMPRLRRRGNG
2641|gene|hwa       ------DISAGT--------------------------QSGEEFRIRNEGIPHLRGRGTG
16260|gene|hbo      ------EIPKGT--------------------------QSGESFRIRNEGMPHLRGRGNG
681|gene|hla        ------DVPTGT--------------------------QSGETFRLKGKGMPRLRRRGRG
346|gene|nph        ------DVPAGT--------------------------QSGETFRLRGKGMPRLKRRGHG
290|gene|hut        ------DIPAGT--------------------------QSGETFRLEGKGMPRLRRRGQG
13334|gene|hma      ------DVPSGT--------------------------QSGEVFRLEGKGMPRLRRRGHG
574|gene|hhi        ------DVPSGT--------------------------QSGEVFRLEGKGMPRLRRRGKG
                                                                                

4197|hp|hhi         -ILLTILALSWHFLFAAIVEVLFMGWDVGWHKIPSKQQIPYTVWSALTGAGVGVIIWAMW
1498|hp|hhi         ---------------------------TSVEKIE--------------------------
382|hp|hhi          ------------------------YAPASEE-----------------------------
489|gene|nrc1       DLYVTVQVVTPESLSDEQRDALEQFAEAGGEEIDVEQGFFEKLKNSF-------------
2641|gene|hwa       DLYVQVQIVTPENLSQKQREALEAFAEAGGESVDVSQGFFEKIKSSF-------------
16260|gene|hbo      DLHVQVQVVTPENLNDEQREALEAFAEAGGEEVNVNEGFFEKIKNSL-------------
681|gene|hla        DLYVKVGVVIPDSLNEEQREALEAFAEAGGEDVDVGGGFFKKLKSSF-------------
346|gene|nph        DLYVQVRVVTPESLNEEQREALEAFAEAGGEEIDVEQGFFEKLKSSF-------------
290|gene|hut        DLLVTVQVYTPESLNDEQREALEAFAEASGEEIDVEKGFFDRLKNSL-------------
13334|gene|hma      DLYVQVQVVTPDSLNAEQKEALEQFAEAGGEEVDVDEGFFEKLKNSL-------------
574|gene|hhi        DLYVQVQVVTPDSLNAEQKEALEQFAEAGGEEVDVEEGFFEKLKNSL-------------
                                               ..                               

4197|hp|hhi         PTYQAPVAYPFAHQYLIGGVAIFAYVYGIIIDPITD
1498|hp|hhi         ------------------------------------
382|hp|hhi          ------------------------------------
489|gene|nrc1       ------------------------------------
2641|gene|hwa       ------------------------------------
16260|gene|hbo      ------------------------------------
681|gene|hla        ------------------------------------
346|gene|nph        ------------------------------------
290|gene|hut        ------------------------------------
13334|gene|hma      ------------------------------------
574|gene|hhi        ------------------------------------