HOG COG KOG arCOG COG description NRC-1 annotation
tucHOG0457arCOG04764hypothetical protein

HOG Organism Gene ID Name Annotation
tucHOG0457 nrc1 VNG1920 vng1920 no entry
tucHOG0457 hmu HMUK1600 Hmuk_1600 conserved hypothetical protein
tucHOG0457 hma RRNAC3291 hypothetical protein
tucHOG0457 hwa HQ3142A hypothetical protein
tucHOG0457 hla HLAC1886 Hlac_1886 hypothetical protein
tucHOG0457 hbo HBOR06510 Hbor_06510 hypothetical protein
tucHOG0457 hut HUTA1278 Huta_1278 conserved hypothetical protein
tucHOG0457 hvo HVO_2213 HVO_2213 conserved hypothetical protein
tucHOG0457 nph NP3172A hypothetical protein
tucHOG0457 hhi 530 HAH_0530 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


3172|hp|nph       --------MPMSDELPEKAVRAFERHDAFER--DGEWFTVTTTTFDGRVTAEETDDWALS
1278|chp|hut      ----------MTDTLPPAVADAFDDHDSFEP--AAEGYRVTTTVFDPTVTATDIEGVGHE
13291|hp|hma      -----------MTDVPDDVAEAFDRHDALVS--AGDSYAVETTNFDGRVTASEGEEWRTN
530|hp|hhi        -----------MTDVPDDVAEAFDRHDALVP--AGDSYAVETTNFDGRVTATEGEKWRTN
1920|hp|nrc1      ---------------MDEIAGEFESHGRFRAV-AERSFAPTTNDWEAVVAVEP-----PG
3142|hp|hwa       -----------MSDIRERTDRAVALHDSIESDGDDDVYAVTTTVFDGDISIETADGAAI-
1886|hp|hla       MTGDGEGAIGGGGDLPDRVRRAFADHGSFEPV-DEGVWVAETTPFDAEVRAEPAADGRIH
6510|hp|hbo       -----------MSDVPERARRAFRDHDSFEQR-DDSTFEWTTTVFDGRVTAAE-DDGEIT
                                        .  *. :        :   *. ::  :           

3172|hp|nph       YTVEVRAPMLSSATEEV-VGPAVEDGWFDTYDRRLEDAPMAVRQDLELDEQRVFEEAGDA
1278|chp|hut      YTVTVRTPMLGAAVEGEVVGPAVADGWFDTFARRLEDATQATRAQIELDQHRLVADDGQA
13291|hp|hma      YEVTVRAPSLQAATSDE-VGDAVVDGWLETLERRLEDAPKATRTAVELDDYSVVEAGEQV
530|hp|hhi        YEVTVRAPSLQAATSDE-VGDAVIDGWFETLERRLEDAPKATRTSVELDDYSVVEDGEQV
1920|hp|nrc1      VEIAVVVPTLDAATTEQ-VADVVSDGWYETFERRVRDADSVTRAE-DVSVSAVTRAGGEI
3142|hp|hwa       FSVVITVPMIDAVVDGH-VAPPVQKGWVDTFGRRMADAESATRGHETLDI-KTTRKDDTA
1886|hp|hla       FVVTVRVPTLSATAADE-VADVVEEGWIETFELRVVDVGGVTRGDHEFDP-TVAVAADEI
6510|hp|hbo       FEVTVRVPMLNAAVEDD-VAPVVEDGWYETFELRVEDIGSVTKAEHDFDV-EVSRDENAV
                    : : .* : :..    *.  * .** :*   *: *   ...    ..           

3172|hp|nph       VAVFGFEWGNADHVPDMTKAIAEYVEGTYMEGIVPGYEYGQPVSEMLSQARQSAGESGRG
1278|chp|hut      VATFVFSYGDPDQAAAIAKTLVEYVEGTYVEGIVPGYDYREPVADLIQNAKTAG-DNERG
13291|hp|hma      VVTFQYTMGGERQAADVAKTFVEYVEGTYVEGVIPGYDYVGVVADLLNSASTGGSEGSRG
530|hp|hhi        VVTFEYTMGGERQAADVAKTFVEYVEGTYVEGVIPGYDYVGVVADLLDSASTGGSEGTRG
1920|hp|nrc1      TVTLTMAP-RSGMAADDALALVNYVEGTWFQGIVPGYDYIEAVRAMREQAAQNA--QEAG
3142|hp|hwa       VVETTFTDIDPSRGVDDAVSLVEFAEGTYVEGVIPGYDYTDPVTQLIQRASDAA-GGKKG
1886|hp|hla       TVDFELTEINERRGVDDAGALINFVEGTYVQGVIPGYEYTEPLDGLLSAARQQG--NSGG
6510|hp|hbo       VVSTSFADINERRGVEDAGAIIDYVEGTYVQGVIPGYEYTKPVSTLLQRATDTA---NSE
                  ..               : :: ::.***:.:*::***:*   :  : . *   .      

3172|hp|nph       PMPL
1278|chp|hut      GTPL
13291|hp|hma      GTPL
530|hp|hhi        GTPL
1920|hp|nrc1      GTPL
3142|hp|hwa       GTPL
1886|hp|hla       GF--
6510|hp|hbo       GPPL