HOG COG KOG arCOG COG description NRC-1 annotation
tucHOG0456arCOG04800replication factor A linked protein

HOG Organism Gene ID Name Annotation
tucHOG0456 nrc1 VNG2163 ral replication factor A linked protein
tucHOG0456 hmu HMUK1029 Hmuk_1029 CopG family protein
tucHOG0456 hma RRNAC2748 CopG family protein
tucHOG0456 hwa HQ3265A hypothetical protein
tucHOG0456 hla HLAC0138 Hlac_138 hypothetical protein
tucHOG0456 hbo HBOR28830 Hbor_28830 hypothetical protein
tucHOG0456 hut HUTA1632 Huta_1632 CopG domain protein DNA-binding domain protein
tucHOG0456 hvo HVO_0290 HVO_0290 ribbon-helix-helix protein CopG family
tucHOG0456 nph NP5152A hypothetical protein
tucHOG0456 hhi 34 HAH_0034 CopG family protein
MUSCLE (3.6) multiple sequence alignment


2163|hp|nrc1        -------------------------------------------------MGNKNKTISFR
3265|hp|hwa         -------------------------------------------MGSANTDKNKNKTISFR
1632|gene|hut       -------------------------------------------------MSNKNKTISFR
12748|gene|hma      MSVAIFADTEVGRRLNHSGSTVVRDGHQGTGPVASDKRLNTLLLKQYIIMGNKNKTISFR
34|gene|hhi         -------------------------------------------------MGNKNKTISFR
5152|hp|nph         -------------------------------------------------MGNKNKTISFR
138|hp|hla          -------------------------------------------------MGNKNKTISFR
28830|hp|hbo        ------------------------------------------MTTFGRFMGNKNKTISFR
                                                                       *********

2163|hp|nrc1        VNEEAFDALSEIAEERNISLSAVFRDYVDSLVTHDGKVRVVPEDSTR----ARDGDDDD-
3265|hp|hwa         VNEDVFETLREIAEERDISLSAVFREYVDTLVAHEGAVQVVPEHEIEELR-AGNGDTADS
1632|gene|hut       VSEEKFETLREIAEERDISLSAVFRDYVDMLVDHSGKVEVVPEHELS----GEAESDDET
12748|gene|hma      VSEDKFETLREIAEERDISLSAVFRDYVDTLVSHDGQVKVAPEHEFED---DATETSTES
34|gene|hhi         VSEDKFETLREIAEERDISLSAVFRDYVDTLVSHDGQVKVAPEHEFED---DATETSTES
5152|hp|nph         VNEEAFETLREIAEERDISLSAVFRDYVDTLVAHDGQVRVVPEHELKSGSASETADAAES
138|hp|hla          VNEDAFETLRDIAEERDISLSAVFRDYVDTLVAHDGQVRVIPEAELE-----SMGDTGES
28830|hp|hbo        VNEDAFETLREIAEERDISLSAVFRDYVDTLVAHDGQVQVVPEHELE----QMNGNDEES
                    *.*: *::* :*****:********:*** ** *.* * * ** .             : 

2163|hp|nrc1        FPPTVEVSKSFVREHERLELEAEHLREQLDEQKAYIDHLRSQTDSEDEIGDVVKLEELD-
3265|hp|hwa         FPPTVTVPKGFVREHERLELEAEHLREQLEEHKQYLNHLQDQLD-EE--EEIIHLEDLER
1632|gene|hut       FPPQVEVPKSFIREHERLELESDHLREQLEEYKRYVTKLREEVN-GDD-EDIIQLEDLDG
12748|gene|hma      FPPKVEVPKSFVREHERLELEAEHLREQLEEHKRYVTKLRQQLD-EMDQDEVIHLEDLDQ
34|gene|hhi         FPPKVEVPKSFVREHERLELEAEHLREQLEEHKRYVTKLRQQLD-EMDQDEVIHLEDLDQ
5152|hp|nph         FPPKVEVPKSFVREHERLELEAEHLREQLEEYKQYVTKLSQQVE-EQEAEDVIQLEDLDG
138|hp|hla          FPPKIEVPKSFVREHERLELEADHLREQLEEHKRYVNYLREQLE-DGD-EEVIQLEDLDG
28830|hp|hbo        FPPKVKVPKSFIREHERLELEADHLREQLEEHKRYVNYLREQLE-DEE-EEVIQLEDLDA
                    *** : *.*.*:*********::******:* * *:  * .: :      ::::**:*: 

2163|hp|nrc1        --DDDEP-YQLG------
3265|hp|hwa         SETDSQS-FRLE------
1632|gene|hut       EQEDEESAYRIGEFDEPV
12748|gene|hma      GEEEDAS-YRIGSFDDLE
34|gene|hhi         GEEEDAS-YRIGSFDDLE
5152|hp|nph         DESEEEP-FRLG------
138|hp|hla          E-PDEPS-FRLG------
28830|hp|hbo        D-ADEPS-FRLG------
                       :. . :.: