HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0455COG2820arCOG01324Uridine phosphorylaseuridine phosphorylase

HOG Organism Gene ID Name Annotation
cHOG0455 nrc1 VNG0893 udp2 uridine phosphorylase
cHOG0455 hmu HMUK2738 Hmuk_2738 purine or other phosphorylase family 1( EC:2.4.2.3 )
cHOG0455 hma RRNAC0448 udp2 uridine phosphorylase
cHOG0455 hwa HQ2647A udp uridine phosphorylase
cHOG0455 hla HLAC0938 Hlac_938 purine or other phosphorylase family 1
cHOG0455 hbo HBOR16440 Hbor_16440 uridine phosphorylase( EC:2.4.2.3 )
cHOG0455 hut HUTA1385 Huta_1385 purine or other phosphorylase family 1
cHOG0455 hvo HVO_1579 HVO_1579 udp Uridine phosphorylase
cHOG0455 nph NP3510A udp_1 uridine phosphorylase 1
cHOG0455 hhi 1186 udp2 uridine phosphorylase
MUSCLE (3.6) multiple sequence alignment


2647|gene|hwa       ----------------------MKNSEDPSDDEQYHLEITADDIAETVLLPGNPGRVETI
3510|gene|nph       -----------------------------MSDDQYHIELSDGDVDGPVLLPGDPDRIDII
10448|gene|hma      ---------------------MTSDSEDPNDDVQYHLEVGEDDVADSVLLPGNPERVEKV
1186|gene|hhi       ---------------------MTSDSEDPNDDVQYHLEVSEADVADSVLLPGNPERVEKV
1385|gene|hut       MFVPVEWTGRELNRFRENTTYMPGDSEDPNEDEQYHLAVTPEDVADIVLLPGNPERIEKI
893|gene|nrc1       ---------------------MPGTSEDPNDEVQYHLEVAAEDIADAVLLPGNPERVDTI
938|gene|hla        ------------------MTDKSDRSEDPNDEVQYHVEVGEDDVADAVLLPGNPERVDKI
16440|gene|hbo      ----------------------MDDSEDPNDEVQYHIELASEDVADAVLLPGNPERVDKV
                                                  .: ***: :   *:   *****:* *:: :

2647|gene|hwa       TEMWDQSTVRGDHREFRTATGTYQETPISVTSTGIGGPSAAIAVEELARIGAETFIRVGS
3510|gene|nph       ADCWDNAEPLADHREYRTAAGEYDGEPLAATSTGIGSPSAAIAVEELARVGAETFIRVGS
10448|gene|hma      VDYWDDHDIVAEHREYRTATGNHDGTPISVTSTGIGGPSAAIALEELARVGADSFIRVGS
1186|gene|hhi       VDYWDDHDIVAEHREYRTATGTHDGTPISVTSTGIGGPSAAIALEELARVGADSFIRVGS
1385|gene|hut       TRFWDESEEKAHHREYRTVSGTYDGTPISVTSTGIGGPGAAIAVEELARAGSDTFIRVGS
893|gene|nrc1       TPLWDDHEEMAHHREYRTATGAYDGTPISVTSTGIGSPSAAIAVEELARAGADTFIRVGS
938|gene|hla        TALWDGHEEVAHHREYRTATGTYEDAPISVTSTGIGSPSAAIAVEELARVGVDTFIRVGS
16440|gene|hbo      TALWDDAEEKAYHREYRTATGTYEGTPISVTSTGIGSPSAAIAIEELARVEAQTLIRVGS
                    .  **     . ***:**.:* ::  *::.******.*.****:*****   :::*****

2647|gene|hwa       CGALSADVAVGDLIISSGAIRQEGTSSEYVRDDYPAVADYEVVSALTAAAEQLGYDYHVG
3510|gene|nph       CGTIQPEVEVGDLVITTAAVRKEGTSDEYIRADYPASAHDEVVTALVTAAERLGHEYHLG
10448|gene|hma      CGAIQEEASIGDLVITTGAVRQEGTSKEYVREDYPASADHRIVSALVAAAEELGYDYHLG
1186|gene|hhi       CGAIQEEASIGDLVITTGAVRQEGTSKEYVREDYPASADHRIVSALVAAAEELGYDYHLG
1385|gene|hut       CGSIREGVSVGDLVITTGAVRQEGTSKEYVREDYPATADHEVVSALTAAAERLDYEYHLG
893|gene|nrc1       CGALQADMEPGDLVITRGAVRQEGTTDEYVREDYPAVADHEVVAALIAAAERLGHDYHVG
938|gene|hla        CGAIQPGMDVGDLVITTGAVRQEGTSDEYVREDYPAAADGEVVSALVAAAERLGYDYHTG
16440|gene|hbo      CGAIQPEMDVGDLVITSGAVRQEGTSKEYVREDYPAVADHEVVSALVAAAERLGYDYHVG
                    **::      ***:*: .*:*:***:.**:* **** *   :*:** :*** *.::** *

2647|gene|hwa       MTLSTDSFYPGQDRMGFNEYTPPGSGSLISDLNEMNVMNIEMEAATLLTIASLYQLRAGA
3510|gene|nph       VTCSTDSFYAGQARDGVGGFRAAGAEAELEALREAGVLNFEMEASTVLTLAGLYGLRAGA
10448|gene|hma      VTCSTDSFYAGQSRPGFEDFEASGSDERIAALQEAGVLNFEMEAATILTLANLYGLRAGA
1186|gene|hhi       VTCSTDSFYAGQSRPGFEDFEASGSDERIAALQEAGVLNFEMEAATILTLANLYGLRAGA
1385|gene|hut       TTMSADSFYSGQGRPGFEGFEAPGSDTLVEDLQEVNVTNIEMEASAILTIANVYGLRAGA
893|gene|nrc1       LTMSADSFYAGQGRDGFEGFRAPGADAMLDELRDANVKNIEMEAAAICTLANVYGLRAGA
938|gene|hla        VTMSADSFYAGQGRPGFEGFEAAGSDELVAELQDANVKNIEMEASAILTIANVYGLRAGA
16440|gene|hbo      LTMSADSFYAGQGRPGFDGFRAAGSDSLVEELQDANVKNIEMEASALLTIANVYGLRAGA
                     * *:****.** * *.  : ..*:   :  *.: .* *:****::: *:*.:* *****

2647|gene|hwa       VCTVYANRETGEFQSGDDTKAAETASLGSHLLAKMDAVKHSVGADRWHAGLSIESE
3510|gene|nph       VCTVYADRTTGEFRTDGQQKAAETASLAAALLSKMDRLKNAAGVDRWHAGLSLDDH
10448|gene|hma      VCTVYANRVTGEFRTEGERKAAKCASLAVSYLAEMDAAVEEADADGWHAGLSIDR-
1186|gene|hhi       VCTVYANRVTGEFRTEGERKAAKCASLAVSYLAEMDAAVEEADADGWHAGLSIDR-
1385|gene|hut       VCAVYANRVTGEFRTESDQRASEVASLATKLLARMDEVKAEAGVDHWHPGLEL---
893|gene|nrc1       VCSVFANRETGEFLTEGESTASETASLAVHLLAKMDQRKAAAGVDQWHAGMSLD--
938|gene|hla        ICSVYANRVTGEFRTEGESRTAETASLAVTLLARMDEVKREAGADRWHAGLSL---
16440|gene|hbo      VCSVYANRVTGEFRTEGESRAAETASLAVHLLAKMDEKKREAGVDRWHAGLSLD--
                    :*:*:*:* **** : .:  ::: ***.   *: **     ...* **.*:.: