HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0453COG1143arCOG01543Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I)NADH dehydrogenase/oxidoreductase-like protein

HOG Organism Gene ID Name Annotation
cHOG0453 nrc1 VNG0640 nolD NADH dehydrogenase/oxidoreductase-like protein
cHOG0453 hmu HMUK1921 Hmuk_1921 NADH-quinone oxidoreductase, chain I( EC:1.6.5.3 )
cHOG0453 hma RRNAC1451 nolD NADH dehydrogenase/oxidoreductase-like protein
cHOG0453 hwa HQ1641A nuoI NADH dehydrogenase-like complex, subunit I
cHOG0453 hla HLAC0708 Hlac_708 NADH-quinone oxidoreductase, chain I
cHOG0453 hbo HBOR21430 Hbor_21430 NADH-quinone oxidoreductase, chain I( EC:1.6.5.3 )
cHOG0453 hut HUTA0702 Huta_0702 NADH-quinone oxidoreductase, chain I
cHOG0453 hvo HVO_0982 HVO_0982 nolD nadh dehydrogenase/oxidoreductase-like protein
cHOG0453 nph NP2300A nuoI NADH dehydrogenase-like complex, subunit I
cHOG0453 hhi 2032 nuoI NADH dehydrogenase subunit I (ubiquinone)
MUSCLE (3.6) multiple sequence alignment


640|gene|nrc1       MIGLLKSMATTMKHALSGDTFTVEYPEEAPEVSARFRGVHKFSQERCIWCRQCENVCPND
702|gene|hut        MIGVLKGMATTMKHALDGKTFTVEYPETAPEVSPRFRGVHKYSQERCIWCRQCENVCPND
2300|gene|nph       MIGMLKSMATTMKHALDGEKFTVQYPEETPEVSPRFRGVHKFSQERCIWCRQCENVCPND
11451|gene|hma      MIGILKSMATTMKHALDGETFTVEYPDVAPEVSPRFRGVHKWSQERCIWCRQCENVCPNN
2032|gene|hhi       MIGILKSMATTMKHALDGETFTVEYPDVAPEVSPRFRGVHKWSQERCIWCRQCENVCPNN
708|gene|hla        MIGLMKSMATTMKHALDGKTFTVEYPEEAPEVSPRFRGVHKFSQERCIWCRQCENVCPND
1641|gene|hwa       MIGLLKSMATTMKHALDGETFTVEYPDVAPEVSPRFRGVHKFSQERCIWCRQCEKVCPND
21430|gene|hbo      MIGLLKSMATTMKHALDGETFTVEYPDVAPEVSPRFRGVHKFSQERCIWCRQCENVCPND
                    ***::*.*********.*..***:**: :****.*******:************:****:

640|gene|nrc1       TIQIVTDNQRNGEQYNLHVGQCIYCRLCEEVCPVDAILLTENFEFTGDTKHDLVFNKEQL
702|gene|hut        TIQIVMDDQRNGEQYNLHVGQCIYCRLCEEVCPTDAIVLTQNFEFVGDTKDDLAYDKEEL
2300|gene|nph       TIQIVTDDMRNGEQYNLHIGQCIYCRLCEEVCPVDAILLTQNFEFTGDTKDDLAYNKEQL
11451|gene|hma      TIQIVMDEQRNGEQYNLHIGQCIYCRLCEEVCPTDAILLTQNFEFTADTKDEFAYDKEQL
2032|gene|hhi       TIQIVMDEQRNGEQYNLHIGQCIYCRLCEEVCPTDAILLTQNFEFTADTKDEFAYDKEQL
708|gene|hla        TIQIVQDDQRNGEQYNLHIGQCIYCRLCEEVCPVDAILLTQNFEFTADTKDDFVFNKEQL
1641|gene|hwa       TIQIVQDDKRNGEQYNLHIGQCIYCRLCEEVCPVDAILLTQNFEFTADTKDEFVYNMEQL
21430|gene|hbo      TIQIVQDDQRNGEQYNLHIGQCIYCRLCEEVCPVDAILLTQNFEFTADTKDEFVYNKEQL
                    ***** *: *********:**************.***:**:****..*** ::.:: *:*

640|gene|nrc1       KNVPWYNDIDPVASREPDRGAWIGDGEGEVDYQ
702|gene|hut        KNVPWYKDIDPLESREPDRGSWIGEGEGEVDYQ
2300|gene|nph       KNVPWYKDIDPLASREPDREAWVGEGDGEVDYQ
11451|gene|hma      KNVPWYKDIDPLESREPDRGAWIGEGDGEVDYQ
2032|gene|hhi       KNVPWYKDIDPLESREPDRGAWIGEGDGEVDYQ
708|gene|hla        KNVPWYKGIDPLESRNPDRGAWIGEGDGEVDYQ
1641|gene|hwa       KNVPWYKDIDPLNSREPDRGGWIDEGAGEVDYQ
21430|gene|hbo      KNVPWYKDIDPLNSREPDRNAWIGEGDGEVDYQ
                    ******:.***: **:*** .*:.:* ******