HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0452COG0505KOG0370arCOG00064Carbamoylphosphate synthase small subunitcarbamoyl-phosphate synthase small subunit

HOG Organism Gene ID Name Annotation
cHOG0452 nrc1 VNG1815 carA carbamoyl-phosphate synthase small subunit
cHOG0452 hmu HMUK1553 Hmuk_1553 carbamoyl-phosphate synthase, small subunit( EC:6.3.5.5 )
cHOG0452 hma RRNAC3363 carA carbamoyl phosphate synthase small subunit
cHOG0452 hwa HQ2774A carA carbamoyl phosphate synthase small subunit
cHOG0452 hla HLAC2325 Hlac_2325 carbamoyl-phosphate synthase, small subunit
cHOG0452 hbo HBOR09060 Hbor_09060 carbamoyl-phosphate synthase small subunit( EC:6.3.5.5 )
cHOG0452 hut HUTA0417 Huta_0417 carbamoyl-phosphate synthase, small subunit
cHOG0452 hvo HVO_2508 HVO_2508 carA carbamoyl-phosphate synthase small subunit
cHOG0452 nph NP4830A carA carbamoyl phosphate synthase small subunit
cHOG0452 hhi 602 carA carbamoyl phosphate synthase small subunit
MUSCLE (3.6) multiple sequence alignment


1815|gene|nrc1      MSDAYLALETGDVVEATARAPGMARGELVFTTAYTGYEESLTDPSYEAQVLTFAYPLIGN
2325|gene|hla       MSDAYIALADGRVLEARARAPGRTRGELVFTTAYTGYEESLTDPSYAEQILTFSYPLIGN
4830|gene|nph       MTDAYVALEDGRVVEARARAPGRTRGELVFTTAYTGYEESLTDPSYEEQILTFSYPLIGN
417|gene|hut        MTDAYVALEGERVVEARARSPGTARGELVFTTAYTGYEESLTDPSYEEQILTFSYPLIGN
13363|gene|hma      MADAYVAIEGDRVIEARARAPGTARGELVFTTAYTGYEESLTDPSYEEQVLTFSYPLIGN
602|gene|hhi        MADAYVAIEGDRVIEARARAPGTARGELVFTTAYTGYEESLTDPSYEEQVLTFSYPLIGN
2774|gene|hwa       MLDAYLALEDGRVIEARGRAPGRTRGELVFTTAYTGYEESLTDPSYEEQVLTFSYPLIGN
9060|gene|hbo       MSDAYLALEDGRVIEARGRSPGQTRGELVFTTAYTGYEESLTDPSYEEQVLTFSYPLIGN
                    * ***:*:    *:** .*:** :**********************  *:***:******

1815|gene|nrc1      YGVRPERTESDRVHPSAVVARELTDDVADWLRTEGVPAVDGIDTRDLVLDIRDGGAMQVG
2325|gene|hla       YGVRSERFESESVQPRAAIARELTDDVAEWLADEDVPAVDHVDTREIVTTVREEGAMACG
4830|gene|nph       YGVREERFESDRVHPRGVVARELTEDVAEWLEDEGVPAVDALDTRDLVTGIREQGAMKCG
417|gene|hut        YGVREERFESDRVHPRAVVARELTDDVAEWLQTEGRPAVDHIDTRELVTEIRDEGAMKCG
13363|gene|hma      YGVREERFESDRVHPRAAVAREMTDDVAEWLESEGIPAVDHLDTRDIVTEIRDEGAMKCG
602|gene|hhi        YGVREERFESDRVHPRAAVAREMTDDVAEWLESEGIPAVDHLDTRDIVTEIRDEGAMKCG
2774|gene|hwa       YGVRSERFESERIHPRAAIAREFTDEIVEWFNHEDVPAIDHIDTRELVTSIREEGAMNCG
9060|gene|hbo       YGVREERFESDRIHPRAAIAHEFTEEVVEWLDSEDVPAIDHIDTRDLVTSIREEGAMKCG
                    **** ** **: ::* ..:*.*:*:::.:*:  *. **:* :***::*  :*: ***  *

1815|gene|nrc1      IAAGPDASPATARAQLADCPRLSARTEIGAHVSVDTAETH--GNGDTTVALVDCGAKRSI
2325|gene|hla       IAAGPDATPEDAVEEMEACEPMSDHVDIGAQVSVTETTVY-EGDGVADVALLDCGAKGSI
4830|gene|nph       IAAGPDATPEDAEAELAECKGMSEHTDIGGQVSVDEQLTFNADGDGPTVALVDCGAKGSI
417|gene|hut        IAAGEDATEEDALAELRQCKHMSDHADIGNQVSVSEPVVYNEGGDGPDVALIDCGAKGSI
13363|gene|hma      IAAGPDVTEQDALDELHECKHMSDHTDIGAQVSVDEVEVHNEGGDGATVALVDCGAKGSI
602|gene|hhi        IAAGPDVTEQDALDELHECKHMSDHTDIGAQVSVDEVEVHNEGGDGATVALVDCGAKGSI
2774|gene|hwa       IAVGSDVTPGDATAELDQCISMSDHIDIGKRVTTVEHTTYGGANAEVHVALIDCGAKMSI
9060|gene|hbo       IAVGDDVTPADAEAQLAKCKGMSEHTEIGAQVSTVEHETY-RGGGEADVALIDCGAKMSI
                    **.* *.:   *  ::  *  :* . :** .*:.    ..   .    ***:***** **

1815|gene|nrc1      IDAFVARGATVHRLPYDATPADIAAVDPDLLFISNGPGDPANFDAAEHLVDEYIGTVPIA
2325|gene|hla       ISSLTERGADVHVLPYDSTPEDVADVDPDVLFVSNGPGDPENFIAAQAVVDAFAGDLPMA
4830|gene|nph       IDSLVDRGATVEMLPYDATADDVKAVDPDVLFISNGPGDPKNFEAAADLVDEYAGNLPLA
417|gene|hut        QESLVERDAVVHVLPYDTTPEAVQDLDPDLLFISNGPGDPENFEAAAELVDEYVGDLPLA
13363|gene|hma      AESLVERDAEVHVFPYDATEDDVAAVDPDLLFISNGPGDPENFEQAGELVETYVGDVPLA
602|gene|hhi        AESLVERDAEVYVFPYDASEDDVAAVDPDLLFISNGPGDPENFEQAGELVETYVGDVPLA
2774|gene|hwa       VDSLVERGVAVHVLPYDTTPEMLTEVDPDLLFISNGPGDPANFEAAQTLVEEYTGEIPIA
9060|gene|hbo       VDSLNERGADVHVLPHDTTAAEVEELDPDLLFISNGPGDPANFGDAQALVEEFVGEIPLA
                     .::  *.. *  :*:*::   :  :***:**:******* **  *  :*: : * :*:*

1815|gene|nrc1      GICLGQQIVARALGGDTEKMDFGHRGVNQPVLDHDSGRVVMTTQNHGYTVADPGD-LTVT
2325|gene|hla       GICLGQQVITSALGGSTEKMAFGHRGVNQPVKDLRTEKVVMTTQNHGYTVADTGP-LEVT
4830|gene|nph       GICLGQQVIANALGGETEKMEFGHRGVNQPVMDLRTEKVVMTTQNHGYTVSEPGE-LDVT
417|gene|hut        GICLGQQVVANALGGDTEKMEFGHRGVNQPVRDLRTDQVVMTTQNHGYTVADPGETLEVT
13363|gene|hma      GICLGQQVVANALGGETEKMEFGHRGVNQPVRDLRSNRVVMTTQNHGYTVADPGDKLDVT
602|gene|hhi        GICLGQQVVANALGGETEKMEFGHRGVNQPVRDLRSNQVVMTTQNHGYTVADPGDKLDVT
2774|gene|hwa       GICLGQQVVARALGGTTEKMNFGHRGVNQPVRDLDSGKVVMTTQNHGYTVGDPGETLNVC
9060|gene|hbo       GICLGQQVIARALGGTTEKMDFGHRGVNQPVRDLNTGKVIMTTQNHGYTVDEPGD-LNVT
                    *******::: **** **** ********** *  : .*:********** :.*  * * 

1815|gene|nrc1      QVNVNDGTPEALDSAPLDVLTRQYHPEANPGPHDTRGFFDDVLAMADASYTPATAD----
2325|gene|hla       QVNVNDDTVEGLDSEELDVITRQYHPEANPGPHDSLGFFDEVLELARSEPPVAAD-----
4830|gene|nph       QVNVNDETPEGLESDELDIITRQYHPEANPGPHDTLGFFDDVLGMVEEPAATQ-------
417|gene|hut        QINVNDDTPEGLENDDLNIITRQYHPEANPGPNDSLAFFDDVLALVE-------------
13363|gene|hma      QINVNDDTPEGLENDDLNIITRQYHPEANPGPHDSLGFFDDVLGMAGE------------
602|gene|hhi        QVNVNDDTPEGLENDDLDIITRQYHPEANPGPHDSLGFFDDVLGMAGK------------
2774|gene|hwa       QINVNDGTAEGLTNRDLDVITRQYHPEAHPGPHDSFGFFDEVLEMTGQDTATETDSSSDR
9060|gene|hbo       QVNVNDDTAEGLENAELNVITRQYHPEAHPGPHDSLGFFDDVLGMVNGTEHKLVADD---
                    *:**** * *.* .  *:::********:***:*: .***:** :.              

1815|gene|nrc1      ------
2325|gene|hla       ------
4830|gene|nph       ------
417|gene|hut        ------
13363|gene|hma      ------
602|gene|hhi        ------
2774|gene|hwa       AVIADN
9060|gene|hbo       ------