HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0451COG1326arCOG02680Uncharacterized archaeal Zn-finger proteinhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0451 nrc1 VNG0094 vng94 no entry
cHOG0451 hmu HMUK0526 Hmuk_0526 conserved hypothetical protein
cHOG0451 hma RRNAC2259 hypothetical protein
cHOG0451 hwa HQ1358A hypothetical protein
cHOG0451 hla HLAC2177 Hlac_2177 hypothetical protein
cHOG0451 hbo HBOR26970 Hbor_26970 uncharacterized Zn-finger protein
cHOG0451 hut HUTA2558 Huta_2558 conserved hypothetical protein
cHOG0451 hvo HVO_0476 HVO_0476 conserved protein
cHOG0451 nph NP0016A hypothetical protein
cHOG0451 hhi 2727 HAH_2727 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


94|chp|nrc1       MNHGVEAGEQVGLSCPSCSPDLETVHEVVTTGGGHATVECGACGHVHKDPIKTEDTEAVD
16|hp|nph         -----MSQQRVAVRCPSCSPAEETAHEVL-NDGGQATVRCGACGHVHKTAIETESTVDRR
2558|chp|hut      ---MSESSQRVGLPCPACSPDLETVHEVL-STGGQATVRCTECDHVHKTSLPEEQTVQRD
12259|hp|hma      -MTDATPGDRIALPCPACSPDLETVHEVL-KPGGHVTVRCTDCDHVHKEQLPEEETLQRS
2727|hp|hhi       -MTDATPGDRIALPCPACSPDLETVHEVL-KPGGHVTVRCTDCDHVHKEQLPEEETLKRS
2177|hp|hla       ---MTETGDRVGLACPSCSPGEETVHEVL-RPGGQATVRCTDCDHTYKTEIPEEETVGLT
1358|hp|hwa       -----MSQNRRGVGCPSCSPSEPTVHEVLSKGGGRHTVRCTACGHVHKVSAETQQVIERD
26970|hp|hbo      ---MSNTQDRIAVACPSCSPAEETVHEVL-KTGGQATVRCTECSHVHKVRIETEQEVEKQ
                        . :. .: **:***   *.***:   **. ** *  *.*.:*     :.     

94|chp|nrc1       VVVSQDGESFTGQTSFDPEETVYEGDEFIVETAETIAQVRVTSIEVGPEDRTTRADVEDI
16|hp|nph         VVVSQDDESTEARVDIPPGESLETGDEFLVETDEAILTARITSLELTSGDRVEEATAEDV
2558|chp|hut      VVVSQDGESFKSTTEPPAEETLAVGEEFLLETEEAIMTVRITSLELA-EGRVEEAQTEDV
12259|hp|hma      VVVSQDGDSFTAEVDVPAEEELSVGEEFLLETEEAVVTARITSLETA-DGREDEAAAEDV
2727|hp|hhi       VVVSQDGDSFTAEVDVPAEEELSVGEEFLLETEEAVVTARITSLETA-DGREDEAAAEDV
2177|hp|hla       VIVSQDGESFSTEMDVPADTYVSTGEEFVVDSPDALMQVRVTGIEVGPEQRVEEADIEDV
1358|hp|hwa       VIISQDGDSFATTTEVSPEEQIAVGDEFIVDSDAAIMLVRVTGIEVGPEQRAEDASVGDI
26970|hp|hbo      VIVSQDGDSFKTMVDAPPEETIAVGEEFIVDTDEAIMLVRITGLETGPEQRAEEAVVEDV
                  *::***.:*     .  .   :  *:**::::  ::  .*:*.:*     *   *   *:

94|chp|nrc1       ETVWTRAVDNVSVDVTVHPKEGS--DEGSRSLELHVPGDFEFVVGETATFGDEEFTVEGI
16|hp|nph         RTLWTRAVGNVAVNLTLHPKEGV--PEESRSVKIQVPGDEAFVVGDTHEYGGEEFTVERI
2558|chp|hut      ETIWTRAVGNVAVNATVHPKSGG--RDETRSEQLHVPGDYEFVVGATDDLGDLSFTVEGI
12259|hp|hma      ETIWSRAVGNVSVNVTMHPKDGT--HDETESFKLHVPGDYEFVVGETEEFGEEEFTVEGI
2727|hp|hhi       ETIWSRAVGNVSVNVTMHPKDGT--HDETESFKLHVPGDYEFVVGETEEFGEEEFTVEGI
2177|hp|hla       ETLWTRAVDNVTVPVTLHPKDGN--ADQTRSLRVNVPGDYEFTVGETVEFGDEEFVVEGV
1358|hp|hwa       RTIWTRAIDNVAVSATVNPKEGTGARESTRSFEIQLPGDHEFTVGETVSFGDEEFLIKAI
26970|hp|hbo      ETIWTRAVDNVSVNVTVNPKEGTGYREDTRSFKVNVPGDYEFVVGETEEFGDEKFAVKAL
                   *:*:**:.**:*  *::**.*    : : *  :::***  *.** *   *  .* :: :

94|chp|nrc1       HVRESATGEYKFPKLGNAGDTVFAKDVKRVYGADES--SAAWSAW
16|hp|nph         MVREDATD-YDREGYDFQGDTVLAKDVKRVYARDEDARTRAWSGW
2558|chp|hut      HLRDDAVG-YQHEKLDHDNDKAFAKDINRLYLRDET--SDAWSAW
12259|hp|hma      HVRDDAHG-YDHENMDHDGDMGIAKDINRLYVRDES--TTAWSAW
2727|hp|hhi       HVRDDAHG-YDHENMDHDGDMGIAKDINRLYVRDES--TTAWSAW
2177|hp|hla       QIREDAPE-YRHEKLDHDGDFAYAKDCKRVYARDES--LTAWSAW
1358|hp|hwa       QVRRDAPE-YRHGKLEHDGDMVYARDIKRVYGTDQT--TSAWSAW
26970|hp|hbo      HVRDDAPE-YRHGKLDHDGDMVYAKDINRLYGTDKT--TSAWSAW
                   :* .*   *        .*   *.* :*:*  *:     ***.*