HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0450COG0179KOG1535arCOG002352-keto-4-pentenoate hydratase/2-oxohepta-3-ene-17-dioic acid hydratase (catechol pathway)2-hydroxyhepta-2.4-diene-1.7-dioate isomerase

HOG Organism Gene ID Name Annotation
cHOG0450 nrc1 VNG1037 hpcE 2-hydroxyhepta-2.4-diene-1.7-dioate isomerase
cHOG0450 hmu HMUK2383 Hmuk_2383 5-oxopent-3-ene-1,2,5-tricarboxylatedecarboxylas e( EC:4.1.1.68 )
cHOG0450 hma RRNAC0511 hpcEa 2-hydroxyhepta-24-diene-1,7-dioate isomerase
cHOG0450 hwa HQ3367A hcpE 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase
cHOG0450 hla HLAC1344 Hlac_1344 histidinol-phosphate aminotransferase
cHOG0450 hbo HBOR19350 Hbor_19350 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene- 1,7-dioic acid hydratase( EC:4.1.1.68 )
cHOG0450 hut HUTA0274 Huta_0274 5-carboxymethyl-2-hydroxymuconateDelta-isomerase
cHOG0450 hvo HVO_1291 HVO_1291 hpcE 2-hydroxyhepta-24-diene-1 7-dioate isomerase
cHOG0450 nph NP2134A hcpE_1 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase
cHOG0450 hhi 1130 hpaG2 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase
MUSCLE (3.6) multiple sequence alignment


1344|gene|hla       MQPRDLSDHSPYVPGRGVEEVARDRGLDPDDLIKLSSNENPHGPSPAAVDAIREHADRVH
2134|gene|nph       --------------------MRQARFEDPDGDVRYGELFE-----DGTVRAYPKQEKRL-
1037|gene|nrc1      -----------------------MRFRTPAGAVRVGEYDP--------------DAEVV-
3367|gene|hwa       --------------------MHRVRFQDPAGSTRDGTW----------------HGDHV-
19350|gene|hbo      --------------------MHRVRFRDPAGSVRTGQW----------------HDDHV-
10511|gene|hma      --------------------MKRVRFRDTGGNVRGGRWTVEDG--EPVVTAAAGPYGRI-
1130|gene|hhi       --------------------MKRVRFRDTAGNVRGGRWTVEDG--DPVVTAAAGPYGRI-
274|gene|hut        --------------------MKRVRFRDPAGTIRGGRWVVEDG--EAYVTTALGASDPV-
                                            *   . .  . .                      : 

1344|gene|hla       QYPKSSHTDLTAKLAEKWDVSTEQVWVSPGADGSIDYLSRAALEPGDEV--LVPEPGFAY
2134|gene|nph       -----------TAAEERFDRDDIEL-LAPCDPSKIVCVGLNYADHADEQGKAVPDRPLLF
1037|gene|nrc1      -----------AAAGRAFDRASVDV-LPPCDPSKVVCVGRNYAAHADERDADVPDRPLLF
3367|gene|hwa       -----------TFGDQTYDINTVSI-LPPSNPTKIVCVGLNYADHAKERNKDIPDRPLLF
19350|gene|hbo      -----------SFGGETYSLAEVEI-LPPCEPTKIVCIGRNYADHAAELDNDVPDRPLLF
10511|gene|hma      -----------AFGDESYDPDEVDI-LPPCEPTKVVCIGRNYADHAEEMDSELPDRPMLF
1130|gene|hhi       -----------AFGDESYDPDEVDI-LPPCEPTKVVCIGRNYADHAEEMDSDLPDRPMLF
274|gene|hut        -----------AADDRTYRASDVDV-LAPAQPTKIVCIGRNFVDHADEQDADVPDRPLLF
                               :     :     .: :.*    .:  :.      . *    :*:  : :

1344|gene|hla       YAMSARYHHGEVSEYALSPDDGFAQDAETVLSAYGGERIVYLTSPHNPSGSVMPLDEVRA
2134|gene|nph       ----------------LKPPNTVAAPEDTLELLADR-QL-----DYEAELGVVIGQRCRN
1037|gene|nrc1      ----------------LKPPTAVAGHGDATPLPPNT-RV-----EHEAELAVVIGTQARN
3367|gene|hwa       ----------------LKPPNTLAGHGDTVTLPANKDRI-----DHEAELAVIIGTQARN
19350|gene|hbo      ----------------LKPPNTLAAHGDTVTLPAGKERV-----DWEAELAVVIGTQARN
10511|gene|hma      ----------------LKAPNAVASHGKHLTMPSGKERI-----DYEAELGVVIGEQCRN
1130|gene|hhi       ----------------LKAPNAVASHGKHLTMPSGKERI-----DYEAELGVVIGEQCRN
274|gene|hut        ----------------LKPPNTVASHGSTVSLLAGKERI-----DHEAELAVVIGETCHD
                                    *..   .*   .      .  .:       :.. .*:     . 

1344|gene|hla       IADATAEETLVVVDEAYGEFAEVDSAIPLVDERDDVAVLRTFSKAYGLAGLRIGYSVVPE
2134|gene|nph       VAEADAMDVV----AGFTCVNDVSN-------RDDQAVETNWVRGKAFDD------AAPL
1037|gene|nrc1      LDAGAAMAAV----EGYTVANDVSN-------RTDQDREQNWVRGKAFDG------SCPL
3367|gene|hwa       VSADDAMEYV----AGFTCLNDLSN-------RDDQDREQNWVRGKGFDN------AAPM
19350|gene|hbo      VAAEDAMDYV----AGFTCMNDVSN-------RDDQNKEQNWVRGKAFDN------SAPL
10511|gene|hma      VSESGAMDVV----AGYTCVNDISN-------RDDQRREQNWVRGKAFDN------ACPI
1130|gene|hhi       VSESGAMDVV----AGYTCVNDISN-------RDDQRQEQNWVRGKAFDN------ACPI
274|gene|hut        VDASDAEDVI----AGYTCFNDLSN-------RDDQRVETNWVRGKAFDN------AAPM
                    :    *   :     .:    ::..       * *     .: .. .: .        * 

1344|gene|hla       AWGEAYARVNTPFAANELACRAALAALDDEEHVAESVETARWAREYIADELDAPTVESAG
2134|gene|nph       --GPAIATPEAVPEDAAIRCR-----VNGDLRQDSSRDQFIFSVPELIAEITS-------
1037|gene|nrc1      --GPVVATPDEVPDDATVALD-----VNGERRQSGSISQFVFDVPTLLAEITA-------
3367|gene|hwa       --GPVLATPDEVPDDATVELR-----VNGEIRQSSTRTELIFSIPELIEEITT-------
19350|gene|hbo      --GPVLATPDEVPDDASVELR-----VNGETKQSSSRDYMMFSVPDLIEEITT-------
10511|gene|hma      --GPLVATPEHVPEDASIELR-----LNGETKQSSSREHLIFSVPELIAEITS-------
1130|gene|hhi       --GPLVATPEHVPEDASIELR-----LNGETKQSSSREHLIFSIPELIAEITS-------
274|gene|hut        --GPVLATPEEVPADASIELR-----VNGETRQSGSREDMVFSVPELIAEITD-------
                      *   *  :       :        ::.: .   :     :    :  *:         

1344|gene|hla       NFVLAEVGDAERVAEEAQERGVIIRDCTSFGLPNHVRISTGTREGTR-----EAVARLNE
2134|gene|nph       -YMTLEPGDV---------------------------VSTGTPEGVGPLADGDTVEVEIE
1037|gene|nrc1      -FVTLQPGDV---------------------------VLTGTPPGVGELTDGDRVAASVE
3367|gene|hwa       -YMTLEPGDV---------------------------ISTGTTSGVAALVDGDHIDITIE
19350|gene|hbo      -YLTLEPGDV---------------------------VSTGTPEGVGPLSDGDHVAVEVE
10511|gene|hma      -YMTLEPGDV---------------------------IATGTPEGVGPMEDGDEVEVEIE
1130|gene|hhi       -YMTLEPGDV---------------------------IATGTPEGVGPMEDGDEVEVEIE
274|gene|hut        -YMTLEPGDV---------------------------IATGTPAGVGPLENGDTVEIEIE
                     ::  : **.                           : ***  *.      : :    *

1344|gene|hla       TLADLGLGV--RA--
2134|gene|nph       GIGTLKNDV--RIP-
1037|gene|nrc1      GVGTLEHTVVREPPA
3367|gene|hwa       GIGTLTHDV--RIP-
19350|gene|hbo      GVGVLEHDV--RSAE
10511|gene|hma      GIGTLKHSV--KIP-
1130|gene|hhi       GIGTLKHSV--KIP-
274|gene|hut        GIGTLEHGV--HIPE
                     :. *   *