HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0449COG0371arCOG00982Glycerol dehydrogenase and related enzymesglycerol 1-phosphate dehydrogenase

HOG Organism Gene ID Name Annotation
cHOG0449 nrc1 VNG0406 esgA glycerol 1-phosphate dehydrogenase
cHOG0449 hmu HMUK3139 Hmuk_3139 3-dehydroquinate synthase( EC:1.1.1.261 )
cHOG0449 hma RRNAC0175 gldA glycerol-1-phosphate dehydrogenase [NAD(P)]
cHOG0449 hwa HQ1560A gldA glycerol-1-phosphate dehydrogenase (NAD(P))
cHOG0449 hla HLAC0655 Hlac_655 3-dehydroquinate synthase
cHOG0449 hbo HBOR23950 Hbor_23950 glycerol dehydrogenase-like oxidoreductase( EC:1.1.1.261 )
cHOG0449 hut HUTA0604 Huta_0604 3-dehydroquinate synthase
cHOG0449 hvo HVO_0822 HVO_0822 3-dehydroquinate synthase
cHOG0449 nph NP4492A gldA glycerol-1-phosphate dehydrogenase [NAD(P)]
cHOG0449 hhi 925 gldA glycerol-1-phosphate dehydrogenase (NAD(P))
MUSCLE (3.6) multiple sequence alignment


10175|gene|hma      MFEKRTWIRLPRNVVVGHGVLGQTIEAVSELHLTGRPLVVSSPTPHDVAGKQVVAQFEDE
925|gene|hhi        MFEKRTWIRLPRNVVVGHGVLGQTIEAVSELHLTGRPLVVSSPTPHDVAGKRVVAQFEDE
604|gene|hut        MFEKSTWIRLPRNVLVGHDVLDRTVEAVEELHLTGRPLIVTGEIPREVAGNAVRQQFADR
1560|gene|hwa       MLKKTTWIKLPRNVLVGHDVIGDLAAAIEELYLDGRPLIVTSPTPDQLIGNRVRSQFA--
406|chp|nrc1        MFEKSTWIRLPRNVVVGHGVLDDAVEVVRDTHLTGRPLVVTSPTPKTVAAENVVAQFEAV
23950|gene|hbo      MFDKSTWIQLPRNVLMGHGVVDELADAVDELYLTGRPFLVTSPTPNDIAGDAVRTQFD--
4492|gene|nph       MFEKSTWIRLPRSVVVGHGVLDRTAEAVEELYLDGRPLIVTSPTPEELAVDRLREQFVSA
655|gene|hla        MFEKTTWIKLPRNVLVGHGVLDDLGEAVGELYLTGRPLIVTSPTPNDIAGDRVRAQFD--
                    *:.* ***.***.*::**.*:.    .: : :* ***::*:.  *  :  . :  **   

10175|gene|hma      GYDPSEIVIEEASFDAVQQVIDHASDIDAGFLLGVGGGKAIDITKMAADDLGLGFVSVPT
925|gene|hhi        GYDPSEIVIEEASFDAVQQVIDHASDIDAGFLLGVGGGKAIDITKMAADDLGLGFVSVPT
604|gene|hut        GHEPAEVLVDEASFAAVQRVIDAAEEANVDYLIGVGGGKPIDLTKMAADELGVGFVSVPT
1560|gene|hwa       --DPQTVSVDHASFDAVEAVIDTAKATDAGYLIGLGGGKPIDTAKMASDRLGCGFVSVPT
406|chp|nrc1        GDDPAVVVVEEATFNSVERVLGEAEAVDPGYLVGVGGGKAIDIAKLASDHLNVGFVSVPT
23950|gene|hbo      --DIASVTIETASFESVERVVDAAEAADAGYLIALGGGKVIDTAKMASDSLDCGFVSVPT
4492|gene|nph       GFDPAVAVVEEASFDAVERVIETAERETAGFLVGFGGGKPIDIAKMAADERNCGFISVPT
655|gene|hla        --DPATAVVEEASFEAVEKLTETAEAVDPGYLIALGGGKPIDIAKMAADHLGVGFVSVPT
                      :     :: *:* :*: :   *.    .:*:..**** ** :*:*:*  . **:****

10175|gene|hma      AASHDGIVSGRGSVPEGDTRHSVAAEPPLAVIADTEVLAEAPWRLTTAGCADIISNYTAV
925|gene|hhi        AASHDGIVSGRGSVPEGDTRHSVAAEPPLAVIADTEVLAEAPWRLTTAGCADIISNYTAV
604|gene|hut        AASHDGIVSGRASVPEDGTRHSVAANPPVAVVADTGILADAPWRLTTAGCADIISNYTAV
1560|gene|hwa       AASHDGIVSGRSSIPEGDTRHSVAADPPLAVVADTAVLAEAPWELTTAGCADIISNYTAV
406|chp|nrc1        AASHDGIVSGRGSVPEGDTRHSVSAAPPLAVIADTGVIADAPWELTTAGCADIISNYTAV
23950|gene|hbo      AASHDGIVSGRSSIPEGDTRHSVAADPPLAVVADTTILAEAPWELTTAGCADIISNYTAV
4492|gene|nph       AASHDGIVSGRGSVPEGDTRHSVAAHPPLAVIADTELIANSPWRLTTAGCADIISNYTAV
655|gene|hla        VASHDGIVSGRSSIPEGDTRHSVAADPPLAVVADTTLIADAPWRLTTAGCADIISNYTAV
                    .**********.*:**..*****:* **:**:*** ::*::** ****************

10175|gene|hma      RDWQLAHRLKNVHYSEYAGALSQMTAEMLVESADSIKQGLEESSWIVVKALVSSGVAMSI
925|gene|hhi        RDWQLAHRLKNVHYSEYAGALSQMTAEMLVESADSIKQGLEESSWIVVKALVSSGVAMSI
604|gene|hut        KDWQLAQRLQNVYYSEYSGALARMTAELLVERADSIKQGLEESAWVVVKALVSSGVAMSI
1560|gene|hwa       KDWQLAHRLQDVEYSEYAGALSQMTAEMLVDNSDAIKQGFEESAWLVAKALVSSGVAMSI
406|chp|nrc1        KDWRLANRLQHVPYSEYAGALSQMTAEMLVDNAANIKPELEESAWVVVKALVSSGVAMSI
23950|gene|hbo      KDWQLAHRLKNAEYSEYAGALSQMTAEMLVDNAESIKPNLEESAWVVVKALLSSGVAMSI
4492|gene|nph       KDWQLAHRLKNVEYSEYAGALSQMTAEMLVDNSASIKRGLEESAWIVVKALVSSGVAMSI
655|gene|hla        KDWRLARRLRNVEYSEYAGALSEMTAELLVENADMIRPGLEESAWVVVKALVSSGVAMSI
                    .**.**.**. . ****:***: ****:**: :  *.  :***:*:*.***:********

10175|gene|hma      ADSSRPASGAEHLFSHQLDRLVPDGALHGHQVGVGSIMTEYLHSGQKGKWRDARDALAAI
925|gene|hhi        ADSSRPASGAEHLFSHQLDRLVPDGALHGHQVGVGSIMTEYLHSGQKGKWRDARDALAAI
604|gene|hut        AGSSRPASGAEHLFSHQLDRLVPDAALHGHQVGVGSIMVEYLHSGENGEWRDIRDALAAI
1560|gene|hwa       AGSSRPASGAEHLISHQLDRLVPDAALHGHQVGVASIVTAYLHTGENGEWEDIRAALADV
406|chp|nrc1        ADSSRPASGSEHLFSHQLDRIAPGKALHGHQVGVGSILAEYLHSGQEGQWMAVRDALASL
23950|gene|hbo      ADSSRPASGAEHLFSHQLDRLVPGRALHGHQVGVGSIVIEYLHSGEKGEWRDIRNALDEV
4492|gene|nph       AGSSRPASGAEHLISHQLDRIAPETALHGHQVGVASIVTEYLHSGEGGDWRRVRDALASI
655|gene|hla        AGSSRPASGAEHLISHQLDRSAPGRALHGHQVGVASIMTEYLHSGENGEWSAIRDALAAL
                    *.*******:***:****** .*  *********.**:  ***:*: *.*   * **  :

10175|gene|hma      GAPTTADELGIDDETVIEALTTAHQIRDRYTVLGDGMSEEAAIEAATVTGVI--
925|gene|hhi        GAPTTADELGIDDETVIEALTTAHQIRDRYTVLGDGMSEEAAIEAATVTGVI--
604|gene|hut        GAPTTADELGIDEATVIEALTTAHEIRDRYTILGNGMSEPAAREAAEVTGVI--
1560|gene|hwa       GAPTTATELGIDEEIFIQAITSAHAIRDRHTILGNGVSEAAAREAAVFTDVC--
406|chp|nrc1        DAPTTADELGVADDEVLAALTSAHEIRDRYTILGGGISEVAAREAASRTGVI--
23950|gene|hbo      GAPTTAAELGIDAETVLEALTTAHTIRDRYTILGDGVSEEAAREAATFTGVI--
4492|gene|nph       DAPTTAAELGIDGERFIEATTSAHEIRDRYTILGDGIEREAAIEAAATTGVL--
655|gene|hla        DAPTTAAELGLDDAELIAALTSAHEIRDRYTILQGGINEAAAIEVATATGVIDG
                    .***** ***:    .: * *:** ****:*:* .*:.  ** *.*  *.*