HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0447COG0537KOG3379 KOG3275arCOG00419Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolaseshistidine triad protein

HOG Organism Gene ID Name Annotation
cHOG0447 nrc1 VNG2186 hit1 histidine triad protein
cHOG0447 hmu HMUK1050 Hmuk_1050 histidine triad (HIT) protein
cHOG0447 hma RRNAC2638 hit2 histidine triad protein
cHOG0447 hwa HQ3651A hit histidine triad (HIT) hydrolase
cHOG0447 hla HLAC0075 Hlac_75 histidine triad (HIT) protein
cHOG0447 hbo HBOR00840 Hbor_00840 HIT family hydrolase, diadenosine tetraphosphate hydrolase-like
cHOG0447 hut HUTA2169 Huta_2169 histidine triad (HIT) protein
cHOG0447 hvo HVO_0230 HVO_0230 hit HIT family protein
cHOG0447 nph NP5090A hit_2 histidine triad (HIT) hydrolase 2 ( bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) )
cHOG0447 hhi 3052 hit2 histidine triad protein
MUSCLE (3.6) multiple sequence alignment


2186|gene|nrc1      -MSDDCVFCQIIADEIPARVVHEDADTLAFLDATPMAPGHTLVIPKTHAATLADTPGDDA
2169|gene|hut       --MTDCVFCAIVEGDVPSDTVHETDDALAFLDANPLAKGHTLVVPKAHHERLGDVPPEEA
12638|gene|hma      -MSEDCIFCQIVAGDIPGRTVYEDDTVLAFLDANPLSPGHTLVIPKAHHERLNDTPADVA
3052|gene|hhi       -MSEDCIFCQIVAGDIPSRTVYEDDTVFAFLDANPLSPGHTLVIPKAHHERLNDTPADVA
75|gene|hla         -MSADCIFCSIVDGDIPARTVHETDDVLAFLDANPLAPGHTLVIPKAHAQHVGDLDDDLA
5090|gene|nph       -MSDRTIFEQIIDGDIPARIVHETETTLAFLDANPLAPGHTLVVPKEPYERLRDLPPELS
3651|gene|hwa       MSEDPTIFEQIAAGDIPARIVHETETIVAFLDANPLAPGHTLVIPRDAYTKLGDLPDDVA
840|gene|hbo        -MGEPTIFEQIAAGDIPARIVYETDTVLAFLDANPLAPGHTLVVPKEAHERLRDLPDDVA
                          :*  *  .::*.  *:*    .*****.*:: *****:*.     : *   : :

2186|gene|nrc1      TAVFETLHALAPTVEAAVDADATTIGFNNGTAAGQEVPHVHGHIIPRFADDDGGPLHVAA
2169|gene|hut       EGFYAALHEVVPAVEAAVDAPATTVAVNNGEPAGQEVPHVHAHVIPRFPDDSAGPVHALF
12638|gene|hma      SAVMSTLHELVPAVESAVDAPASTVAFNNGEVAGQEVPHVHGHIIPRFEDDGGRPIHVLV
3052|gene|hhi       AEVLSTLHELVPAVEAAVDAPASTVAFNNGEVAGQEVPHVHGHIIPRFEDDGGRPIHTLV
75|gene|hla         SDLFAAVTELTPRVQAAVDAEGANVGINDGEAAGQEVPHVHVHVIPRFEGDGGAPLHAVG
5090|gene|nph       ADVFETVRTVTPAVQDAVDADATTIGINDGPEAGQEVPHLHVHIVPRFEGDGGGPIHGVA
3651|gene|hwa       TELWATVQSLTPTIETAVDADATTIGVNNGSAAGQEVPHVHIHIIPRFDDDGGGPIHATA
840|gene|hbo        TDLWAAVDELTPRVEDAVDADALTVGVNDGEAAGQEVPHVHVHLVPRFDGDGGGPIHAVA
                      .  ::  :.* :: **** . .:..*:*  *******:* *::*** .*.. *:*   

2186|gene|nrc1      GTRPDVSDADLDATAADITDRLA-
2169|gene|hut       TDRPRIGDTERESIVADIAANI--
12638|gene|hma      NDRPDISDDELDDIENDIVAEQA-
3052|gene|hhi       NDRPDLSDDELDAIEDDIVAEQA-
75|gene|hla         GKRPDLSEEELDAIADDVAAAIDE
5090|gene|nph       GKTPELGDEELDTIADDIAEGLD-
3651|gene|hwa       GARPELSDSELDTIAMNIESTADL
840|gene|hbo        GSRPDLSDEELDDIAERIET----
                       * :.: : :     :