HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0446COG0063 COG0062KOG2585 KOG3974arCOG00018hypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0446 nrc1 VNG1272 vng1272 no entry
cHOG0446 hmu HMUK2405 Hmuk_2405 carbohydrate kinase, YjeF related protein
cHOG0446 hma RRNAC1168 hypothetical protein
cHOG0446 hwa HQ2341A sugar kinase
cHOG0446 hla HLAC1235 Hlac_1235 carbohydrate kinase, YjeF related protein
cHOG0446 hbo HBOR18850 Hbor_18850 yjeF-like protein, hydroxyethylthiazole kinase- related
cHOG0446 hut HUTA0826 Huta_0826 carbohydrate kinase, YjeF related protein
cHOG0446 hvo HVO_1348 HVO_1348 Short chain dehydrogenase fused to sugar kinase
cHOG0446 nph NP3748A sugar kinase
cHOG0446 hhi 1771 HAH_1771 carbohydrate kinase, YjeF-like protein
MUSCLE (3.6) multiple sequence alignment


2341|gene|hwa       -----MITSARMAAVDRNAEALGVSPQQLMESGGNAVAKTVRELTDVDVESETPPVAVIV
1272|chp|nrc1       -----------MAAVDRNAAALGVPRAQLMESSGHAVGRAVKRVADPGASVA------IV
826|gene|hut        MTFGSELTGREIAIVDANAAALGVTRKQLMESAGNAAAGVIRDVADADDRIE------IV
1235|gene|hla       -----MITTDRMAAVDANAAALGVPRKQLMESSGNAVAREVRAIADPGASVE------LL
3748|gene|nph       -----MISSEEMAVVDANAEALGVPRKQLMESSGNAVARVVESVADPDASVA------MV
18850|gene|hbo      -----MITSDRMAAVDENAEAFGVPRKQLMESSGNAVARAVRDIADPGAQVA------VV
11168|hp|hma        -----MLTGSEMGVVDENAAALGVPRKQLMESSGHAVARAVRTLADPGDQVT------IV
1771|gene|hhi       -----------MGVVDENAAALGVPRKQLMESSGHAVARAVRTLADPGDQVT------IV
                               :. ** ** *:**.  *****.*:*..  :  ::* .          ::

2341|gene|hwa       AGRGNNGGDGFVTARFLDEYIVSVLLLGRPETIRTSTAKQNWEALMKGGYDTTVVQDTSS
1272|chp|nrc1       AGRGNNGGDAFAAARFLDDYAVSVSLLGRPESINDRISRANWDALQAGGYDTTTVRDAHA
826|gene|hut        AGRGNNGGDALVAARFLGAYDCRVTLLGDPDDIGTDIARENWDALERSTVETRTIGDSTA
1235|gene|hla       CGRGNNGGDAFVAARFLSAYDVTVRLLGRPESIRTEIARENWDALKSAAIPTETVADAAD
3748|gene|nph       CGRGNNGGDAFVAARFLSDYDVTVSLLGRAETIRTDIARENWTALQQAAIDTTEITAPDD
18850|gene|hbo      AGRGNNGGDAFVAVRFLDDYDVTVHLLGRPETISTDIARENWDALEASEYDTRTVTDSKA
11168|hp|hma        AGRGNNGGDALVTARFLDEYDLRVLLLGRPDAISTTIARENWDALQHAEYPTEPVKDSSA
1771|gene|hhi       AGRGNNGGDALVTARFLDEYDLRVLLLGRPDAISTTIARENWDALQHAEYPTETVRDSSA
                    .********.:.:.***. *   * *** .: *    :. ** **  .   *  :  .  

2341|gene|hwa       IEIVGPNGESPDIVVDAMLGTGVTGALREPEATAASQINHTDATVLSVDVPSGVNADTGS
1272|chp|nrc1       LAL-----DDPDVVVDALLGTGISGPPREPEATAIERINATDAPTVAVDVPSGLDADTGA
826|gene|hut        FDL-----SDPDVIVDAMLGTGISGALREPVATAAGAINEADATVVSLDVPSGLDASTAA
1235|gene|hla       LAL-----DDPDVIVDAMLGSGITGALREPERTAARLANESDAAVVAVDVPSGIDADTGE
3748|gene|nph       LSL-----DDADVVVDAMLGTGITGALREPEASAAEAINATDATVVAVDVPSGIDADTGE
18850|gene|hbo      LGL-----GDPDVVVDAMLGTGVTGALREPEATAAEAVNDLDATVVAVDVPSGVDADTGT
11168|hp|hma        FDL-----GSPDIVVDAMLGTGIAGALREPEATAATAMNESDATVLSVDVPSGLDAETGR
1771|gene|hhi       LDL-----GTPDVVIDAMLGTGIAGDLREPAATAATAMNESDATVLSVDVPSGLDAETGR
                    : :       .*:::**:**:*::*  ***  :*    *  **..:::*****::*.*. 

2341|gene|hwa       STGVA------VEPNHVVTFHDQKPGLTAIDAGVTVADIGIPQAAEQTAGPGDLYSLSRP
1272|chp|nrc1       TPGSA------VDADRVVTFHDTTPGLADHD-HVTVADIGIPEAAETVVGPGDLLGVDRD
826|gene|hut        LADGA------VRPDRVVTFHKPKPGLSELGVPVDVADIGVPPGAEYFVERGDLLRLSRP
1235|gene|hla       STGSGDDDVVRVEADRVVTFHDEKPGLTALDADVTVADIGIPAAAERFTGPGDLLGIARD
3748|gene|nph       RHGVA------VAADHVVTFHDEKPGLEAIAVPVTVADIGIPDAAERFVERGDLLRLSRD
18850|gene|hbo      AAGVA------VDADRVVTFHDEKPGLASLDAAVTVADIGIPAAAELFVGPGDLHH-TRR
11168|hp|hma        LAENA------VDADHVVTFHDTKPGLPDLDVPVTVADIGIPDTAELFIERGDLTRLERD
1771|gene|hhi       LADNA------VDADHVVTFHDTKPGLPDLDVPVTVADIGIPDAAELFIERGDLTRLERD
                        .      * .:.*****. .***      * *****:*  **     ***    * 

2341|gene|hwa       TQSHKGDFGEVLIIGGGPYTGAPALSAQAALRAGADLVRIACPVAIADEIQSYSESLIVR
1272|chp|nrc1       PHGHKGDAGSVLVIGGGPYTGAPALCAQAALRAGADLVRLAVPDAVAAEVQGFDETFIVD
826|gene|hut        ADSHKGDFGEVLVIGGGPYTGAPALAAQSALRSGADLVRVAVPAAIADEVQGYSEDLIVR
1235|gene|hla       PNSHKGENGEVLVIGGGPYTGAPSLSARSALRTGADLVRVACPETVARTVQGYSADLIVR
3748|gene|nph       PTAHKGDFGRVLVVGGGPYAGAPALSAQAALRAGADLAFVACPEAVAGEVQGYSENLIVE
18850|gene|hbo      SQSHKGDHGEVLVVGGGPYTGAPALSAQAALRAGADLVRVACPKSVAREIQGYSENLIVR
11168|hp|hma        PASHKGDNGEVLVVGGGPYTGAPALTAQAALRSGADLVRVACPAVVAREIQSYSENLIMR
1771|gene|hhi       PASHKGDNGEVLVVGGGPYTGAPALTAQAALRGGADLVRVACPAVVAREIQSYSENLILR
                    . .***: * **::*****:***:* *.:*** ****. :* *  :*  :*.:.  :*: 

2341|gene|hwa       AYPGERLTPTALEHVQSLAVDHDVTVLGPGLGDDEKTLSVVASFLRGHTGTVVVDADALS
1272|chp|nrc1       SVVGTRLVEEHVPDLLARAEDADAVVIGPGLGDADTTQAAVAAFLAAFEGRAVVDADALT
826|gene|hut        PFDGTQLTEPAVDPLLDLAADHDSVVLGPGLGAGEATLSAVEAFLADFEGTAVVDADALR
1235|gene|hla       GLPGNRIGPAHVDRALELAAGNDVVVLGPGLGDSDGVSEFVREFLSRYDGRAVVDADALR
3748|gene|nph       PLPGDRLAPPHVPDLLERAAAVDCVVFGPGLGDDEATLSAVEAFFEGFEGTAVVDADALQ
18850|gene|hbo      PFDGDHLQPSHVDGLTALAADHDVVVFGPGLGDEDATLDAVADFLESYEGTAVVDADALQ
11168|hp|hma        PFDGDHLAPHHVDRLAELAADHDTLIVGPGLGNADATLDAVADLLSGFAGTAVVDADALS
1771|gene|hhi       PFDGDHLAPPHVDNLAELAAEHDTLIVGPGLGNADATLEAVGDLLSGFEGTAVVDADALS
                       * .:    :      *   *  :.*****  : .   *  ::  . * .******* 

2341|gene|hwa       VVPTVDPAGKIICTPHQGELEAMGGETADDWEHRAKKMSAFISELSDSHTLLVKGAIDII
1272|chp|nrc1       AVPDVETDATLVCTPHRGELQAMGGPTVDGSQPSRDAVEGFAAEL--GQTLLVTGARDVL
826|gene|hut        VVPDVETEATLICTPHRGEFERMGGQDAADWETRAENVAELAAEL--GMTLLVKGPADII
1235|gene|hla       VVPEIDTDAELICTPHQGELVGMGGETADDPDERAALVRSFADEI--GHTLLVKGAVDVV
3748|gene|nph       VVPDVETDAELLCTPHQGELRKMGSETAADPAERASLVSAFAADL--GVTLLLKGAEDII
18850|gene|hbo      VVPEVDTDATLVCTPHQGELLKMGGKTADDWRERTDLVESFAAEL--GHVLLVKGAYDII
11168|hp|hma        VVPDIETDADLVCTPHQGELLGMGGETAEDWRERADLVESFAAEV--GQTLLVKGPYDIV
1771|gene|hhi       VVPDIETDADLVCTPHQGELLGMGGETSEDWRERVDLVESFASEV--DQTLLVKGPYDIV
                    .** ::. . ::****.**:  **.    .       :  :  ::  . .**:.*. *::

2341|gene|hwa       SNGETTRINRTGNPGMTVGGTGDILAGVVGALACVLSPIQAATVGAYANGRAGDITVEKR
1272|chp|nrc1       SDGDTTRVNRSGTPGMTVGGTGDVLAGTAAAMLATQPPIQAASAAAYATGGAGERAAEAR
826|gene|hut        SDGKSTRVSRTGNPGMTVGGTGDVLAGVTGALAATLDPHPAASLGAYVTGRAGDLVVEER
1235|gene|hla       SDGDGVRLNHTGNPGMTVGGTGDVLAGAVGALAAVTDSFHAAAVGVYANGLAGDAAADDM
3748|gene|nph       TDGDRTRRNRTGNPGMTVGGTGDVLAGAAGALACVLDTQDAAAVAAYANGRAGDIVVEEQ
18850|gene|hbo      SDGEVTRVNRTGNPGMTVGGTGDVLAGTTGALACVRNARHAAAVGAYANGRAGDAAVEEN
11168|hp|hma        SNGERTRVGRTGNPGMTVGGTGDVLAGVTGALASVQDPLDAAAIAAYTVGSVGDRVVDDR
1771|gene|hhi       SDGERTRVGRTGNPGMTVGGTGDVLAGVTGALACVQEPLDAAAIAAYTVGTVGDQVVDDR
                    ::*. .* ..:*.**********:***...*: ..  .  **: ..*. * .*: ..:  

2341|gene|hwa       GNGLLATDLLETIPTALQDPKDVTAGVSSDD
1272|chp|nrc1       GHGLLATDICDALPAAIWGGQDA--------
826|gene|hut        GYGLVASDLLDRVPTAMWDEQP---------
1235|gene|hla       GYGLVATDLPDRLPEAMRDE-----------
3748|gene|nph       GYGLVATDLTAALPKALWPDD----------
18850|gene|hbo      GYGLLATDLVDRLPVALRRDE----------
11168|hp|hma        GYGLVATDLLDEIPSVLWQRDAEP-------
1771|gene|hhi       GYGLVATDLLDEIPSVLWQREAEA-------
                    * **:*:*:   :* .:.