HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0445COG0468KOG1564 KOG1433 KOG1434arCOG00417RecA/RadA recombinasepossible DNA recombinase (also called radB)

HOG Organism Gene ID Name Annotation
cHOG0445 nrc1 VNG1665 radA2 possible DNA recombinase (also called radB)
cHOG0445 hmu HMUK1786 Hmuk_1786 DNA repair and recombination protein RadB
cHOG0445 hma RRNAC1532 radB DNA repair and recombination protein RadB
cHOG0445 hwa HQ3173A radB DNA repair and recombination protein RadB
cHOG0445 hla HLAC1629 Hlac_1629 DNA repair and recombination protein RadB
cHOG0445 hbo HBOR08160 Hbor_08160 DNA repair and recombination protein RadB
cHOG0445 hut HUTA0907 Huta_0907 DNA repair and recombination protein RadB
cHOG0445 hvo HVO_2383 HVO_2383 radB DNA repair and recombination protein RadB
cHOG0445 nph NP1788A radB DNA repair and recombination protein RadB
cHOG0445 hhi 2104 radB DNA repair and recombination protein RadB
MUSCLE (3.6) multiple sequence alignment


3173|gene|hwa       ---MSRLLSTGCQSLDSLLGGGFERGTVTQVYGPPAAGKTNIMLSAALHTAATDSMAVYV
1665|gene|nrc1      VREDDTHLPTGCGALDELLGGGVERGTVTQLYGPPAAGKTNVALTTAVTTAAAGGLAVYV
907|gene|hut        ---MSDPISTGCDAVDDLLGGGLERGAVTQIYGQPAAGKTNLALGAAVETAAAGESALYL
1788|gene|nph       ---MSEPIPTGCDTVDTLLGGGFERGTVTQLYGPPASGKTNLALSAAVQVAADGGTALYI
8160|gene|hbo       ---MSESVTTGCRSLDDLLGGGFERGTVTQVYGPPAAGKTNVALSAAVRVAAAGGTVVYI
2383|gene|hvo       ---VTESVSTGCDALDDLLDGGFERGTVTQVYGPSAAGKTNVALSAAVRVAAAGGTVVYI
1629|gene|hla       ---MSDPIPTGCRPVDDLLGGGFERGVVTQVYGPPAAGKTNLALAAAVEVAAGGDRALYI
11532|gene|hma      -----------------------------------------------MEVAAAGDAALYI
2104|gene|hhi       ---MSEYVPTGCDAIDDLLGGGLERGAVTQVYGPPAAGKTNFALSAVMEVAAAGDAALYI
                                                                   : .** .  .:*:

3173|gene|hwa       DTEGISSDRFRQIADGVVDD-SSSVDRDSLTSQVIMSDAHDFEAQATAVRDTAEFANRAD
1665|gene|nrc1      DTEGLSLARFQQLLEARA------TDPEAASANVIVSDAHDFDEQAQAVRDTADFADRAD
907|gene|hut        DTEGVSIDRLEQLADARG-------DVSELASRIILTEAHTFEEQQEAVRDAEEFASQVD
1788|gene|nph       DTEGVSLDRFEQLARGAT------DDLEGTTSRVIISDALDFDDQREAVQDAGDLAATAD
8160|gene|hbo       DTEGLSVDRFQQLAEHVA---GPEQSIEDVTSRLIVSEAHDFEEQEEAVRDTTEFAEQAD
2383|gene|hvo       DTEGLSVDRFQQLAEAVA-----PEDVESVTSRLMISEAYDFEDQEQAVRDAEEFAASAD
1629|gene|hla       DTEGLSIDRFEQMAAGRANRPDVDETVEEIASRLVISEAYDFDDQREAVRDAEELAEEIE
11532|gene|hma      DTEGLSADRMEQVARGRA-R-GTAQTVDDLAGRLIITEALDYDEQTEAVQDAAEFAAEVE
2104|gene|hhi       DTEGLSADRMEQVAKGRA-R-GTAQTVDDLAGRLIITEALDYDEQAEAVQDAAEFAAEVE
                    ****:*  *: *:              .  :..:::::*  :: *  **.*: ::*   :

3173|gene|hwa       LIILDSATGFYRLQRTLGGTLENNIGTDGASSENTERTETADGGDTLRRLTSQITHLLSL
1665|gene|nrc1      LIVVDSVTGFYRL----------------------ARGGDDTTGDALRQVADQITHLLSL
907|gene|hut        LIVLDSATGFYRL----------------------ERTEQED-GEALRAVARQITHLLAL
1788|gene|nph       LVVLDSATGFYRL----------------------ER-DTDDDGETLREVATQVTHLLGL
8160|gene|hbo       LVVLDSATGFYRL----------------------ERTMDKDGGESLRRVARQVTHLLSL
2383|gene|hvo       LIVLDSATGFYRL----------------------ERTAEGDGGEALRRVARQVTHLLSL
1629|gene|hla       LIVLDSATGFYRL----------------------ERAGDTEGGESLRKVAKQVTHLLSL
11532|gene|hma      LIVLDSATGFYRL----------------------RR-DDEDGGETLRDVARQITHLLSL
2104|gene|hhi       LIVLDSATGFYRL----------------------RR-DDEDGGETLRDVARQITHLLSL
                    *:::**.******                       *      *::** :: *:****.*

3173|gene|hwa       ARKHNLAVVITNQVFTDPDTD--RVRPLGGYTLEHWTGAVLRLERFRGGKRRATLEKHRS
1665|gene|nrc1      ARKHDLAVVVTNQVFTDVDNDSDRARPLGGHTLAHWTGTVLRLDRFRGGTRRATLEKHRA
907|gene|hut        ARKHDLAVAFTNQVFSDPDGD--RVRPLGGHTLNHWSSLVLRLDRFRGGKRRATLEKHHA
1788|gene|nph       ARRHDLAVVITNQVYTDPEADSSRVRPLGGHTLSHWSGTVLRIERFRGGNRRATLEKHQA
8160|gene|hbo       ARKHDLAVVITNQVFSDPDSD--QIRALGGHTLEHWTGAVLRIDRFRGGNRRATLEKHRA
2383|gene|hvo       ARKHDLAVVLTNQVYADPDSD--RTRALGGHTLEHWTGTVVRLDRFRGGNRRATLEKHRA
1629|gene|hla       ARRHDIAVVITNQVFTDPDSD--RDRALGGNTLNHWTGAIVRVDRFRGGNRRVTLEKHRS
11532|gene|hma      ARKHDIAVLYTNQVFTDPDSD--RSTALGGHTLNHWSGAIVRLDRFRGGNRRATLEKHRA
2104|gene|hhi       ARKHDIAVLYTNQVFTDPDSD--RSTALGGHTLNHWSGAIVRLDRFRGGNRRATLEKHRA
                    **.*::**  ****::* : *  .  .*** ** **:. ::*::*****.**.*****.:

3173|gene|hwa       KPTGESVTFVITDTGVADHEPIS---
1665|gene|nrc1      KPDGEHAQFQITDGGIDAASADDY--
907|gene|hut        KATGDTARFQITDAGMSGVEEI----
1788|gene|nph       KAAGETARFKITDSGLEGVDEGV---
8160|gene|hbo       KPAGETATFEITDGGISSTQL-----
2383|gene|hvo       KPAGETATFKITDRGLSATDV-----
1629|gene|hla       KPAGDTATFQIVADGLAESAET----
11532|gene|hma      KPAGDTAQFRITDSGLVGDDTPETPQ
2104|gene|hhi       KPAGDTAQFRITDAGLVGDDTPETPK
                    *. *: . * *.  *: