HOG Organism Gene ID Name Annotation
aHOG4443 nrc1 VNG0486 hat1 probable acetyltransferase
aHOG4443 nrc1 VNG0487 vng487 no entry
MUSCLE (3.6) multiple sequence alignment


486|gene|nrc1      ------------------------------------------------------------
487|hp|nrc1        MQCPRPTWCRPGAPRPTERRRTRNHYMRRRRREWYVRKCDWTGLRWTPTRGTPSGRNRTA
                                                                               

486|gene|nrc1      ------MPGPIV---TEGDRVTLRTVERDDAAHLQRSCTDPRIRHSLGSVHHRSREQQAD
487|hp|nrc1        GGGGSVMPGPILEVSDDTDDLVLRTVERDDAAFVQRAFADPYARCALHVGTHKSEAEVET
                         *****:    : * :.**********.:**: :**  * :*    *.*  :   

486|gene|nrc1      GIEHWVEDDGSVVAVVCVDDEDAPPGQPAADETTPIGSFSARHVDSDRAWLAYWLRPEYT
487|hp|nrc1        FIEEEVEDDGNAAYIACVDAEDAPFDHPDAAETTAVAFLYVRHVDHDQPTVVCWVPPEHR
                    **  *****... :.*** **** .:* * ***.:. : .**** *.. :. *: **: 

486|gene|nrc1      GSGYGRDMATTGIDYVFAQYGVHNVSAAAYDFNEASRGLLAAMGFTEVGRRREARYIDGG
487|hp|nrc1        GAGHAGPALELGLDALWRVSDVHTVGASVVSVDEFTRDLVSAVGFTEEARNREAQFVDGA
                   *:*:.      *:* ::   .**.*.*:. ..:* :*.*::*:**** .*.***.::**.

486|gene|nrc1      YADEVWYDVLRREWTADRER
487|hp|nrc1        YRDEIHYGLLRTEWEAQ---
                   * **:.*.:** ** *: