HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0444COG1102arCOG01037Cytidylate kinasecytidydylate kinase

HOG Organism Gene ID Name Annotation
cHOG0444 nrc1 VNG1727 cmk cytidydylate kinase
cHOG0444 hmu HMUK1734 Hmuk_1734 cytidylate kinase( EC:2.7.4.14 )
cHOG0444 hma RRNAC3343 cmk cytidylate kinase
cHOG0444 hwa HQ2765A cmk cytidylate kinase
cHOG0444 hla HLAC1813 Hlac_1813 cytidylate kinase
cHOG0444 hbo HBOR09220 Hbor_09220 cytidylate kinase, putative( EC:2.7.4.14 )
cHOG0444 hut HUTA2321 Huta_2321 cytidylate kinase
cHOG0444 hvo HVO_2494 HVO_2494 cytidylate kinase putative
cHOG0444 nph NP4914A cmk cytidylate kinase
cHOG0444 hhi 584 cmk cytidylate kinase
MUSCLE (3.6) multiple sequence alignment


1727|gene|nrc1      MLVTISGPPGSGKSTVASTLADHLSYEHISGGDIFRGLAEDRDLTLAEFNELAEEDPQID
2765|gene|hwa       MLLTVSGPPGAGKSTTADTLAATFGLEHVSGGDIFRELAAERGLTAVELNQQAEEDDQID
9220|gene|hbo       MLLTVSGPPGAGKSTTVATLAEAFGLEHISGGDIFRQLAAERDMTAVEFNKLAEKDDQID
1813|gene|hla       MLITVSGPPGSGKSTNAAGLADRLGLDHVSGGDIFREMAAERDMTPVEFNEFAEEDPQID
4914|gene|nph       MLITISGPAGSGKSTVAAGLAESLGYEHVSGGDIFRDLADDRGLTPLELNKRAEEDDQID
2321|gene|hut       MLITVSGPAGSGKSTLAASLADALDYDHVSGGDIFRSLADERGMTPLELNKQAEEDDEID
13343|gene|hma      MLITVSGPAGSGKSTLAKSLADALNYEHVSGGDIFRSLAEERGMTPLELNKAAEEDDQID
584|gene|hhi        MLITVSGPAGSGKSTLAKSLADALSYEHVSGGDIFRSLAEERGMTPLELNKAAEEDDQID
                    **:*:***.*:**** .  **  :. :*:******* :* :*.:*  *:*: **:* :**

1727|gene|nrc1      KDLDRRLRETARGRDDIVLESRLAGWMAGEYADIKIWLDAPMSVRARRIAEREDKTPAAA
2765|gene|hwa       RDLDQRLRTIALERDDILLESRLAGWLAGDAADIRVWLDAPLNVRAGRIADREDKSISTA
9220|gene|hbo       RDLDRRLRTIALERDDVLLESRLAGWLAGDAADIRLWLDAPLDVRAERIAEREDKSLDVA
1813|gene|hla       RDLDRRLHEIATTRDDLVLESRLAGWLSADHADFRFWFDAPVSTRAERIAEREEKPVDRA
4914|gene|nph       RDLDRKQRDIAESRDDIVLESRLAGWMAGEHADFRIWLDAPLSVRAERIADREDKSVELA
2321|gene|hut       RDLDRRLRDVARDRDDLVLESRLAGWMAGDHADLKLWLDAPLSVRAERISQRENKPVEQA
13343|gene|hma      RDLDRKLRDIAAERDDLVLESRLAGWMAGEYADMKLWLTAPLDVRADRIATRENKPFEQA
584|gene|hhi        RDLDRRLRDIAAERDDLVLESRLAGWMAGEYADMKLWLTAPLDVRADRIATRENKPFEQA
                    .***.. .  *  ***::********::.: **:..*: **:..** **: **:*.   *

1727|gene|nrc1      RAETEAREESETQRYEEYYAIDFDDITIYDLSVNTARWGPDAVTDIVLDAVDAYQAERDE
2765|gene|hwa       QEETRTREESEALRYQNYYNIDIHDHSIYDLRVNTARWPKTEVPDILEAAIAAYEPASDE
9220|gene|hbo       REETRAREESEALRYEEYYNIDITDLGIYDITLNTARWSEEDVPSVLKAAVEAYDPEDDE
1813|gene|hla       KAETERREASEKKRYREYYDIDIGDLSIYDAAYNTARWGPERFIDVLVATIDAYDPATDE
4914|gene|nph       HNETKERGKSEALRYREYYNIDIEDRSIYDLALNTARLSPDGVRAVVESAVNAYAPDDDE
2321|gene|hut       RTETRERAESEAHRYREYYDIDIEDLSIYDLAINTARWSPQGMLSVVLHAVESYDQNGDE
13343|gene|hma      KTETRERGDSEAQRYSDYYDIDFDDLSIYDLSVNTARWDPQGVLSVTLHAVESYSPDGDE
584|gene|hhi        KTETRERGDSEAQRYSDYYDIDFDDLSIYDLSVNTARWDPQGVLSVTLHAVESYSPDGDE
                    . **  *  **  ** :** **: *  ***   ****     .  :   :: :*    **

1727|gene|nrc1      GPTPIENVRYQF
2765|gene|hwa       GRFPIEDIIYDF
9220|gene|hbo       GKFPVEGVNYDF
1813|gene|hla       GKAPIEGVSYDF
4914|gene|nph       GQTPVEGVTYEF
2321|gene|hut       GKAPIQGVEYDF
13343|gene|hma      GKAPVENIRYEF
584|gene|hhi        GKAPVENVRYEF
                    *  *::.: *:*