HOG COG KOG arCOG COG description NRC-1 annotation
nucHOG0443arCOG01916hypothetical protein

HOG Organism Gene ID Name Annotation
nucHOG0443 nrc1 VNG0195 vng195 no entry
nucHOG0443 hmu HMUK0167 Hmuk_0167 conserved hypothetical protein
nucHOG0443 hma RRNAC2001 hypothetical protein
nucHOG0443 hwa HQ1413A hypothetical protein
nucHOG0443 hla HLAC0525 Hlac_525 hypothetical protein
nucHOG0443 hbo HBOR26230 Hbor_26230 hypothetical protein
nucHOG0443 hut HUTA2408 Huta_2408 conserved hypothetical protein
nucHOG0443 hvo HVO_0583 HVO_0583 Ribbon-helix-helix protein copG family domain protein
nucHOG0443 nph NP5328A hypothetical protein
nucHOG0443 hhi 2507 HAH_2507 hypothetical protein
nucHOG0443 hhi 330 HAH_0330 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


330|hp|hhi        ---------------------------MPSLKDSIDDAAGFEVDLDIQWES---------
195|hp|nrc1       --------------------------MRNALRAYLTTHAAADDVPVESVNT-PVRG----
1413|hp|hwa       MSKITFRADDDLVGQLEEFEGSKSEVMREALRTYLENTEAMHEGGNGSLNN---------
26230|hp|hbo      MSKITFRADDELVERLEGLETSKSEVMRDALRVYLDEAERSSEANETDEPEVTVDDVLQS
525|hp|hla        MSKITFRADDDLVEQLEACDASKSEVMREALRTHLDGAVGDDADASDATDA-TVDAALAD
5328|hp|nph       MSKITFRADEDLIRQLETFDASKSEVMREALREYLDDAGGDTGGRPPTDNGGSIDD----
2408|chp|hut      MSKITFRADDDLVTQLEGFDASKSEVMREALRTYLEGSDHESSEAESSPEPTSAEE----
12001|hp|hma      MSKITFRADDDLIDQLEAFDASKSEVMREALREYLGDASPSASDPPSSASE-SVTD--AE
2507|hp|hhi       MSKITFRADDDLIDQLEAFDASKSEVMREALREYLGDASPSASEPPSAASE-SVTD--AE
                                               :*.  :                         

330|hp|hhi        ----LIDER---------------------------VNEELWFEGWTKVYFLPTISA---
195|hp|nrc1       ----------------------------AATDAQKDVNVTIRVSSPSAVEEVRTTPASGG
1413|hp|hwa       ---DLNSDTTHHTTGNK------NH---TGESAGRKVTVNIVLDDESGIVYANKQEDAVA
26230|hp|hbo      RLDELIEERVDAVLAKRLGAV--GH---STLAPPRDVNVNIAVESATDETSVNAT-----
525|hp|hla        RIDDLIADRLDAALDDRLGGRSAASPAAYTPGNAGDINVNVTLDAPSADKDDASV-----
5328|hp|nph       SLDDLIAERVDAILDERLGGHLGAS---YTPREPQDVNVNISLSGDSAEMSHGTDES---
2408|chp|hut      SLDDLIVERVDAVLAERLGE--------RRQPQPQDVNVNISLEDAAPSTSATTAPP---
12001|hp|hma      TIDELIEERVDSIIADRLQTR-------HHHPQPQDVNVNISLDGVSAGAANAETEQRRT
2507|hp|hhi       TIDELIEDRVDSIIADRLQTR-------QPRSQPQDVNVNISLDGVSAGAASAETEQQRA
                                                      :.  : ..  :             

330|hp|hhi        -FEAICSDKLGREALEAELESVVFK---------------NVAGMTGEINYSDGVLTVD-
195|hp|nrc1       RADAEEPGDDGETDAEHADTSATGDE--------------SVCSQCGAELSADHVYCPNC
1413|hp|hwa       -TAAGKPDTAIDAEVNRKTSSSEEI---------------SECNKCGKALIDGHVYCPNC
26230|hp|hbo      -EDGSKSDSKIRKTNDEDASGVHTQE--------------KPCEKCGEELSPDDVYCPNC
525|hp|hla        -TREATADADAQTRKTPTDPDVQTRE--------------NACGGCGENVPTDHVYCPNC
5328|hp|nph       -RKTPAEDTAGASDTDA-----------------------ESCKQCGEDLSPSDVYCPNC
2408|chp|hut      -DAEETTDAVTDRNTE------------------------RTCSQCGESVSDDHVYCPNC
12001|hp|hma      -ADRGASAEDGRSHSESQASDTSGRKTEPETRERSDTEERKTCAQCGENLGSDHVYCPNC
2507|hp|hhi       -GSRGESTESGRSHDESQTSDTSGRKTEAETRDRAETEERKTCAQCGENLGSDHVYCPNC
                                                            .   *     . *   : 

330|hp|hhi        ------KEPCTNMDKVDK---------RTESIVSLLEGSL
195|hp|nrc1       GGKATHRVFCECGDEIRADWAFCPRCGRRTVSGDALDSA-
1413|hp|hwa       GEKAAHRVFCECGDEIQSDWAFCPSCGRRTSAADVLEKSS
26230|hp|hbo      GEKANHRVFCECGDEVRSDWAFCPGCGRRTSAADVLEQG-
525|hp|hla        GEKQSHRAFCDCGDELRTDWAFCPGCGRRTPAADVLKDR-
5328|hp|nph       GEKASHRVFCECGDELRSDWGFCPSCGRRTPAADVLKDS-
2408|chp|hut      GEKAARRVFCECGDELRSDWSFCPSCGRRTAAADVLDQ--
12001|hp|hma      GEKASRRVFCDCGDELRSDWGFCPGCGRRTPAADVLDQT-
2507|hp|hhi       GEKASRRVFCDCGDELRSDWGFCPGCGRRTPAADVLDQT-
                        .  *   *::           *     . *.