HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0442COG0550 COG0551KOG1956arCOG01527DNA topoisomerase I

HOG Organism Gene ID Name Annotation
cHOG0442 nrc1 VNG0349 topA DNA topoisomerase I
cHOG0442 hmu HMUK3010 Hmuk_3010 DNA topoisomerase I( EC:5.99.1.2 )
cHOG0442 hma RRNAC1645 topA DNA topoisomerase I
cHOG0442 hwa HQ1267A topA DNA topoisomerase I
cHOG0442 hla HLAC0259 Hlac_259 DNA topoisomerase type IA central domain protein
cHOG0442 hbo HBOR25370 Hbor_25370 DNA topoisomerase I( EC:5.99.1.2 )
cHOG0442 hut HUTA2731 Huta_2731 DNA topoisomerase I
cHOG0442 hvo HVO_0681 HVO_0681 topA DNA topoisomerase I
cHOG0442 nph NP1222A topA DNA topoisomerase I
cHOG0442 hhi 2187 topA DNA topoisomerase I
cHOG0442 hhi 293 HAH_0293 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


293|hp|hhi          ------------------------------------------------------------
349|gene|nrc1       ----VELIVTEKNNAARRIADILSEGGASTTQTAGVNVYEWGGRRCIGLSGHVVGVDFPP
1222|gene|nph       ----MELIVTEKDNAARRIAEILSDGSASTERRNGVNVYRWGDKRCVGLSGHVVGVDFPP
2731|gene|hut       ----MRLIVTEKDNAARRIAEILSDDSASGERRNGVNVYKWGGQRVVGLSGHVVGVDFPP
11645|gene|hma      ----MRLIITEKDNAARRIAEILSEGGASANRRNGVNVYRWGNTRVVGLSGHVVGVDFPE
2187|gene|hhi       ----MRLIITEKDNAARRIAEILSEGSASASRQNGVNVYRWGNTRVVGLSGHVVGVDFPE
1267|gene|hwa       MSQGPELIITEKDNAARRIADILSGDSATADREQGVNVYKWGGKRCIGLSGHVVAVDFPQ
25370|gene|hbo      MSKGPELIITEKDNAARRIADILSGESAEADRINGVNVYKWGGKRCIGLSGHVVGVDFPP
259|gene|hla        MSRGPELIITEKDNAARRIADILSGESATAERENDVNVYKWGGKRCIGLSGHVVGVDFPA
                                                                                

293|hp|hhi          ------------------------------------------------------------
349|gene|nrc1       EYNDWRDVEPAELIHADVVKDPTQEDIVNALQRLAREADDVVIATDYDREGELIGKEAYE
1222|gene|nph       EYEDWRDVQPVELVEADVVKKPTQENIVRTLKQLAGEADRATIATDYDREGELIGKEAYE
2731|gene|hut       EYAEWRDVEPAELIDADVVTTPTRENIVATLRSLARKADEVVIATDYDREGELIGKEAYE
11645|gene|hma      EYNDWRDVEPVELIDADVTKEPTQENIVTTLKQLAREADEATIATDYDREGELIGKEAYE
2187|gene|hhi       EYNDWRDVEPVELIDADVTKEPTQENIVTTLKQLAREADEATIATDYDREGELIGKEAYE
1267|gene|hwa       EYSDWRDVEPVELIDAPIEKNPTKQNIVTTLKKLARRARRVIIATDYDREGELIGKEAYE
25370|gene|hbo      EYNDWRDVEPVELIDAPIDKHPTQENIVAALRRLARNARRVVIATDYDREGELIGKEAYE
259|gene|hla        EYNDWRDVEPVELIDAPITKEPTQEGIVAALRKLARNASRVVIATDYDREGELIGKEAYE
                                                                                

293|hp|hhi          ------------------------------------------------------------
349|gene|nrc1       LVREVNEQAPVNRVRFSSITDTEVRSAFADPDDIDFDLAAAGEARQIVDLMWGASLTRFL
1222|gene|nph       LIRE-EADIPIQRVRFSSITENEVKEAFATPDDLDFDLAAAGEARQIVDLLWGAALTRFL
2731|gene|hut       LIRE-ETDAPVERVRFSSITEREVQKAFENPDEIDFDLAAAGEARQIVDLIWGAALTRFL
11645|gene|hma      LIRE-ETDAPVDRVRFSSITEREVRDAFANPDDIDFDLAAAGEARQIIDLVWGAALTRFL
2187|gene|hhi       LIRE-ETDAPVDRVRFSSITEREVRDAFANPDDIDFDLAAAGEARQIIDLVWGAALTRFL
1267|gene|hwa       LVRRVNESTPIDRVRFSSITEESVTTAFENPDDLDFNLAAAGEARQVIDLVWGAALTRYL
25370|gene|hbo      LVRDVNEDVPVDRVRFSSITDREVTEAFDNPDGLDFNLAAAGEARQIVDLVWGAALTRFL
259|gene|hla        LVREVNEDAPIDRVRFSSITDNEVNEAFANPDELDFDLAAAGEARQVIDLTWGAALTRFL
                                                                                

293|hp|hhi          ------------------------------------------------------------
349|gene|nrc1       SLSAGQMGEDFISVGRVQSPTLKLIVDKEREIEAFDPDDYWELFADLRK----------D
1222|gene|nph       SLSANQLGDDFISVGRVQSPTLKLIVDREREIEAFDPDDYWELFADLAR----------E
2731|gene|hut       SLSAKQLGNDFISVGRVQSPTLKLIVDREREIEAFDPDDYWEILADLAK----------D
11645|gene|hma      SLSARQLGDDFISVGRVQSPTLKLIVDREREIQAFDPEDYWEIFADLQK----------N
2187|gene|hhi       SLSARQLGDDFISVGRVQSPTLKLIVDREREIQAFDPEDYWEIFADLQK----------N
1267|gene|hwa       SLSAGQLGSDFISVGRVQGPTLKLIVDREREIEAFDPEDYWELFVDLTQADKPIEVSTDD
25370|gene|hbo      SLSARQLGDDFISVGRVQGPTLKLIVDREREIEAFDPEDYWELFADLQK----------D
259|gene|hla        SLSARQLGEDFISVGRVQGPTLKLIVDREREIKAFDPEAYWELYGNLTK----------S
                                                                                

293|hp|hhi          ------------------------------------------------------------
349|gene|nrc1       -QTTFEAQYFYEDPADGTEAERVWNEGDADAAFDALRQAGEAVVDSVSRRTRTDDPPAPF
1222|gene|nph       -GTTFEAQYFYRE--DGTEQERVWDESGAETAFETLRNAGTAVVESVRRRRRTDEPPEPF
2731|gene|hut       -GQGFEAQYFYDD--DGSEAERVWDEAAAEAAYADLSESGTATVTEVRRRTRTDDPPAPF
11645|gene|hma      -GSGFEAQYFYDD--DGKEAERVWVEDDADDAYADLTNVDAATVTSVRRRTRTDSPPTPF
2187|gene|hhi       -GSGFEAQYFYDD--DGKEAERVWVEDDADDAYADLTGVNAATVTSVRRRTRTDSPPTPF
1267|gene|hwa       TAAEFEAQYFYHA-DDGTEAERITEESTAKTVFETLESASIAHVDSVKRRTRTDEPPAPF
25370|gene|hbo      -SESFEAQYFYLD-EDGNEAERVWDGDDAEEAYETLRNVEAATVDSVRRRTRTDDPPAPF
259|gene|hla        GGDPFEARYFYLN-DEGNEAERVWNGDVAEVLTEAFDAADEAVVDDVRRRTRTDDPPTPF
                                                                                

293|hp|hhi          ------------------------------------------------------------
349|gene|nrc1       NTTQFIRAAGSLGYSAGRAMSIAEDLYTAGYITYPRTDNTVYPDDLDERDLLEAFQQT-V
1222|gene|nph       NTTQYISAANGIGLSAQRAMSVAEELYTAGYITYPRTDNTVYPDDLDPEALLSAFTDHYL
2731|gene|hut       NTTAFISAASSLGYSAQRAMSLAEELYTDGYLTYPRTDNTVYPDDLDPEELLGAFEGSYE
11645|gene|hma      NTTAFISAASSLGYSAQQAMSIAEELYTTGYITYPRTDNTVYPDDLEEDALLDEFVGAGH
2187|gene|hhi       NTTAFISAASSLGYSAQQAMSIAEELYTTGYITYPRTDNTVYPDDLEEDALLDEFVGAGH
1267|gene|hwa       NTTQFISAAGSIGYAAQRAMDIAEDLYTAGYITYPRTDNTVYPDELDPRELIEALTNGSR
25370|gene|hbo      NTTQFIRAAGSLGYSAQRAMSIAEDLYTAGYITYPRTDNTVYPEDLDPRELLDAFTANRT
259|gene|hla        NTTAFIRAAGSLGHSAQRAMSLAEDLYTAGYVTYPRTDNTVYPEDLDPRELIEELSVAST
                                                                                

293|hp|hhi          ------------------------------------------------------------
349|gene|nrc1       FGDDADSLLDQDRLSPTSGDEETTDHPPIHPTTDFPDRNQLSEDEWAVYELVVRRFFATV
1222|gene|nph       FADDAEMLRSADDIEPTAGDEETTDHPPIHPTGEIPNKDDLSDDEWEVYELVVRHFFATV
2731|gene|hut       FGDDAASLLDQDEIEPTRGETESTDHPPIHPTGELPDRDEVGADAWEIYELVVRRFFATV
11645|gene|hma      FGEDAEALLEQDDITATEGDEETTDHPPIHPTGEIPPKADLSDDEWEIYELVVRRFFATV
2187|gene|hhi       FGEDAEKLLEQDDITATEGDEETTDHPPIHPTGEIPPKVDLSDDEWEIYELVVRRFFATV
1267|gene|hwa       FGSDARDVLDQETLSPTTGDEETTDHPPIHPTDELPKPSELDDDKWEVYELIVRHFLATV
25370|gene|hbo      FGDDAQNLLEQEEIEPTAGDNETTDHPPIHPTGELPSRSDLTEDEWDVYELVVRRFFATV
259|gene|hla        FGKDAKSLLEQEEIEPTEGDEETTDHPPIHPTGELPSASDLSEDEWEVYELIVRRFLATC
                                                                                

293|hp|hhi          ------------------------------------------------------------
349|gene|nrc1       AAPAEWAHLRVTADA--------------------------------DGESLKANGKRLV
1222|gene|nph       ADAAEWEHLKVVADA--------------------------------DGCSLKANGKRLV
2731|gene|hut       AEPATWAHLRVVAEA--------------------------------AGRSLKANGKRLL
11645|gene|hma      AEAATWEHLRVVADA--------------------------------GGRSLKANGKRLV
2187|gene|hhi       AEAATWEHLRVVADA--------------------------------GGRSLKANGKRLV
1267|gene|hwa       SNPATWEHLRIVAIV-------------------------------DDTYSIKSNGRRLL
25370|gene|hbo      AESAKWEHLRVVADA--------------------------------GGLSLKANGKRLV
259|gene|hla        AEPATWERLRVVALANDEATAIAERADGLAALRNPEEASGPGDLVADGGLRLKANGKRLL
                                                                                

293|hp|hhi          ------------------------------------MQASIPQR---------------A
349|gene|nrc1       EAGYHAVYPYYDSSENHVPPVEEGDTLAITDARLDAKQTQPPRRYGQSRLIETMESMDIG
1222|gene|nph       EPGYHEVYPYRSTSENHVPAVEEGEQLAIEDARIEEKQTQPPRRRGQSRLIEELESRGLG
2731|gene|hut       EEGYHAVYPYSSAGETFVPEVSEGDKLSIDAVELEAKQTQPPRRYGQSRLIQHMEEMGIG
11645|gene|hma      EPGYHEVYPYSSASENHVPDVEEGEELAISEVRMEAKQTQPPRRYGQSRLIQTMEDKGLG
2187|gene|hhi       EPGYHEVYPYSSASENHVPDVEEGEELAISEVRMEAKQTQPPRRYGQSRLIQTMEDKGLG
1267|gene|hwa       NPGYHAVYPYSNATESLIPDIEDGETLRLIDSRIEAKQTQPPRRYGQSRLIETMESMGIG
25370|gene|hbo      KAGYHEVYPYFNSSESFVPDVAEGESLAVTDTEIEEKQTQPPRRYGQSRLIETMEKMGIG
259|gene|hla        EAGYHDVYPYRSSDERIVPDVEVGETLALTDRRTDAKETQPPRRYGQSRLIEEMEKRGVG
                                                         ::. *.*               .

293|hp|hhi          TE----------------------------------------------------------
349|gene|nrc1       TK----------------------------------------------------------
1222|gene|nph       TK----------------------------------------------------------
2731|gene|hut       TK----------------------------------------------------------
11645|gene|hma      TKCLTADSDVLVRSENGDIERQTVDSLFSDGQVVLADGDTDIAVSKETPTVLSLDEATER
2187|gene|hhi       TK----------------------------------------------------------
1267|gene|hwa       TK----------------------------------------------------------
25370|gene|hbo      TK----------------------------------------------------------
259|gene|hla        TK----------------------------------------------------------
                    *:                                                          

293|hp|hhi          ------------------------------------------------------------
349|gene|nrc1       ------------------------------------------------------------
1222|gene|nph       ------------------------------------------------------------
2731|gene|hut       ------------------------------------------------------------
11645|gene|hma      VSEQESTLVSERPLRDDESVRTIETSRGAVTVTDDHPMYIRQDGEVTVRPASDIEAGTDL
2187|gene|hhi       ------------------------------------------------------------
1267|gene|hwa       ------------------------------------------------------------
25370|gene|hbo      ------------------------------------------------------------
259|gene|hla        ------------------------------------------------------------
                                                                                

293|hp|hhi          ------------------------------------------------------------
349|gene|nrc1       ------------------------------------------------------------
1222|gene|nph       ------------------------------------------------------------
2731|gene|hut       ------------------------------------------------------------
11645|gene|hma      VAARRPPDTMVEPSDETVLSWETFAADCDKHSKLYGVDCGTELAAQRAARDESQTAFAER
2187|gene|hhi       ------------------------------------------------------------
1267|gene|hwa       ------------------------------------------------------------
25370|gene|hbo      ------------------------------------------------------------
259|gene|hla        ------------------------------------------------------------
                                                                                

293|hp|hhi          ------------------------------------------------------------
349|gene|nrc1       ------------------------------------------------------------
1222|gene|nph       ------------------------------------------------------------
2731|gene|hut       ------------------------------------------------------------
11645|gene|hma      YGSYGSAVGKYERGEKDVPVWLLGELDIRPDRIHGLNYETSFENPFPLEWSPELAQVIGC
2187|gene|hhi       ------------------------------------------------------------
1267|gene|hwa       ------------------------------------------------------------
25370|gene|hbo      ------------------------------------------------------------
259|gene|hla        ------------------------------------------------------------
                                                                                

293|hp|hhi          ------------------------------------------------------------
349|gene|nrc1       ------------------------------------------------------------
1222|gene|nph       ------------------------------------------------------------
2731|gene|hut       ------------------------------------------------------------
11645|gene|hma      LLGDGSIHRNDDENVVDVRYHNTDEALIERFARDIERLFDIEPTVTDRPGRESHHKRKYQ
2187|gene|hhi       ------------------------------------------------------------
1267|gene|hwa       ------------------------------------------------------------
25370|gene|hbo      ------------------------------------------------------------
259|gene|hla        ------------------------------------------------------------
                                                                                

293|hp|hhi          ------------------------------------------------------------
349|gene|nrc1       ------------------------------------------------------------
1222|gene|nph       ------------------------------------------------------------
2731|gene|hut       ------------------------------------------------------------
11645|gene|hma      VDVPSAVGRVLVCVLEAVTENGTPGLPDAVRPAFVGALFDDEGHISREGKAFISNTDHTL
2187|gene|hhi       ------------------------------------------------------------
1267|gene|hwa       ------------------------------------------------------------
25370|gene|hbo      ------------------------------------------------------------
259|gene|hla        ------------------------------------------------------------
                                                                                

293|hp|hhi          ------------------------------------------------------------
349|gene|nrc1       ------------------------------------------------------------
1222|gene|nph       ------------------------------------------------------------
2731|gene|hut       ------------------------------------------------------------
11645|gene|hma      LTGVGEMLAEMGIETKLAPDQHKLHIRGRRNLEQFLDRIPIASDEKFYRGLDALDAYDVT
2187|gene|hhi       ------------------------------------------------------------
1267|gene|hwa       ------------------------------------------------------------
25370|gene|hbo      ------------------------------------------------------------
259|gene|hla        ------------------------------------------------------------
                                                                                

293|hp|hhi          ------------------------------------------------------------
349|gene|nrc1       ------------------------------------------------------------
1222|gene|nph       ------------------------------------------------------------
2731|gene|hut       ------------------------------------------------------------
11645|gene|hma      TRKAELLEAIRQEPKTSAALAQTLGVTRGSVNKYLRELRESGHIEKQIEGSNRSLDENRT
2187|gene|hhi       ------------------------------------------------------------
1267|gene|hwa       ------------------------------------------------------------
25370|gene|hbo      ------------------------------------------------------------
259|gene|hla        ------------------------------------------------------------
                                                                                

293|hp|hhi          ------------------------------------------------------------
349|gene|nrc1       -----------------------------------------------------------S
1222|gene|nph       -----------------------------------------------------------S
2731|gene|hut       -----------------------------------------------------------A
11645|gene|hma      VQYVAADFEGSVYATLRGEPSSVTVEDVERREYDGPVYDLTVSENAPNFAVNGGAVVHNS
2187|gene|hhi       -----------------------------------------------------------S
1267|gene|hwa       -----------------------------------------------------------S
25370|gene|hbo      -----------------------------------------------------------A
259|gene|hla        -----------------------------------------------------------A
                                                                                

293|hp|hhi          ------------------------------------------------------------
349|gene|nrc1       TRHNTIEKLYDRGYIENDPPRPTTLAEAVVEAAEDYADVVVSEEMTSQLEADMTAIADGE
1222|gene|nph       TRHNTLQKLYDRGYIESDPPRPTKLAMAVVEAAEQFADRIVDEEMTAQLESDMQAIVDGE
2731|gene|hut       TRHNIVEKLYDRGYVEDDPPRPTKLAEAVVSAAEEYADHVVSEEMTAQLEADMTAIAEGE
11645|gene|hma      TRHNSIEKLYDRGYIEGDPPRPTTLAMAVVEAAEEFADHVVSDEMTAQLEADMTAIANGE
2187|gene|hhi       TRHNSIEKLYDRGYIEGDPPRPTTLAMAVVEAAEEFADHVVSDEMTAQLEADMTAIANGE
1267|gene|hwa       SRHNVIQKLYNRGYIESDPPRPTQLARAVVEAAEEFAELIVSEEMTAQLETDMQAIAEGE
25370|gene|hbo      TRHDVIQKLYDRNYIESDPPRPTRLARAVVEASEEFAELIVSEEMTAQLEADMQAIARGD
259|gene|hla        TRHRTLEKLYDRNYIESDPPRPTRLAEAVVEAAEEFAEHVVSEEMTAQLERDMQAIAAGE
                                                                                

293|hp|hhi          ------------------------------------------------------------
349|gene|nrc1       TTLDDVTTESREMLDRVFDELTASRAEIGDHLRTSLKADKSLGPCPECGDTLLLRQSRTG
1222|gene|nph       KDLEAVTEESRALLGRIFDELHDSREEIGEHLQESMKADRMLGPCPECGEDLLIRRSRKG
2731|gene|hut       ATLEEVTAESREMLGEIFEELRESRTEIGEFLQESLKADRTLGPCPECGEDLLVRRSRQG
11645|gene|hma      ATLDDVADESREMLKRVFDELRDSREEIGEHLQESLKADKTLGPCPKCGEDMLVRRSRQG
2187|gene|hhi       ATLDDVADESREMLKRVFDELRDSREEIGEHLQESLKADKTLGPCPKCGEDMLVRRSRQG
1267|gene|hwa       ETLESVTSASRSILTDVFKKLMNTDAEIGDHLQRSMKADKTIGPCPQCEGDLITRKSQAG
25370|gene|hbo      ASLDDVTAESREILEDVFEGLMESGDEVGKHLQKSLKADKTVGACPESDHDLVVRKSRRG
259|gene|hla        KGYDEVTEASRELLNRVFDDLTESREAVGDHLQKSLKADKTLGPCPECGSDLLVRKSRQG
                                                                                

293|hp|hhi          -------------------------------------------GAKSHTYGCPLC-----
349|gene|nrc1       SHFVGCDGYPECQFTLPLPSTGDPLVMDAVCEDHDLHDVKMLAGRNTFVHGCPLCAAEAA
1222|gene|nph       SYFVGCDGFPDCRYTLPLPSQGEPTVIDEACTEHDLNHVKMLAGRSTFVHGCPQCKADEA
2731|gene|hut       SYFVGCDGFPECRFTLPLPSTGEPQVTDETCEDHDLRHVKMLAGRDTFVHGCPRCKAEAA
11645|gene|hma      SYFVGCDGFPECRNTLPLPSTGEPQVLEDHCEEHDMHHVKMLAGRDTFVHGCPRCEAEKA
2187|gene|hhi       SYFVGCDGFPECRNTLPLPSTGEPQVLEEHCEEHDMYHVKMLAGRDTFVHGCPRCEAEKA
1267|gene|hwa       SHFIGCDSYPDCEYTLPLPSTGKPHILETVCDVHNLQQIKMLAGKRSFVHGCPLCEAEAA
25370|gene|hbo      SYFIGCDGYPDCTYTLPLPSTGKPLIMDEECDEHGLSHVKMLAGRKTFVHGCPLCKAEEA
259|gene|hla        SYFVGCDGYPDCEYTLPLPSSGKPLLLDETCEEHELRHVKMLAGRKTFVHGCPQCKADEA
                                                               *  :..:*** *     

293|hp|hhi          ------------NCG----------------ADSEDDIY------------------CHL
349|gene|nrc1       DESEDRLIGPCPDCG----------------EPHGGELAIKQLQSGSRLVGCDRYPDCEY
1222|gene|nph       DETDDRIIGDCPDCG----------------DNADGELAIKQLRSGSRLVGCTRYPECEY
2731|gene|hut       DESEDEVIGHCPECGDSAAPEGQRNEGGEAAEGEGGKLAIKHLRSGSRLVGCTRYPDCDY
11645|gene|hma      DESEDEVIGPCPECG----------------SEHDGDLAIKHLRSGSRLVGCTRYPDCDY
2187|gene|hhi       DESEDEVIGPCPECG--VAPAEQRGDGGEAAEAEGGELAIKHLRSGSRLVGCTRYPDCDY
1267|gene|hwa       DEQADRVIGTCPECN----------------AHADGELAIKRLRSGSRLVGCTRYPDCEY
25370|gene|hbo      DAEEDLIIGDCPECGAGAESETPQNGDGET-DGEHGELAIKRLRSGSRLVGCTRYPDCDY
259|gene|hla        DEQEDEVIGACPECG----------------EEHGGELAIKRLRSGSRLVGCTRYPDCDY
                                :*.                    ..:                   *  

293|hp|hhi          LVSHRKSALVDALLERVDSDELARV-----------------------------------
349|gene|nrc1       SLPLPRRGDIEVTETYCDEHALPELVVHDGEDD-----------DPWELGCPICNYEEYQ
1222|gene|nph       SLPLPRRGDIEVLDERCADHDLPHLRVVD-NGD-----------DPWELGCPICNYTEYR
2731|gene|hut       SLPLPRRGEIVVTDERCEDHDLPHIEIHDGDDD-----------DPWELGCPICNYEEFQ
11645|gene|hma      SLPLPRNGDISVTEAFCEEHDLPELVI-DADSD-----------DPWELGCPICNYEEYQ
2187|gene|hhi       SLPLPRNGDISVTEAYCEEHDLPELVI-DADSD-----------DPWELGCPICNYEEYQ
1267|gene|hwa       SLPLPRQGEIDVTDNICDEHALPALQILEADENTTKDKTTKESDDIWELGCPICNYREYQ
25370|gene|hbo      SLPLPRRGDIEVTDEECEEHDLPEIRITYDDSDR----------EPWDLGCPICNYRAYQ
259|gene|hla        SLPLPRRGEIEVTDEICEEHGLPHLRVHSGD-------------EPWELGCPICNYREFT
                     :.  . . : .      .  *. :                                   

293|hp|hhi          ------------------------------------------------------------
349|gene|nrc1       ARQRQQ-GLEALDGVGPKTAAKLESAGVEDVGALADADPEGIADAVSGVSADTIREWQAQ
1222|gene|nph       EQQAAS-AIEDLDGVGQKTAEKLADAGIESLSDLRGADAEAVANEVQGVSEDRLREWQAE
2731|gene|hut       ARNAVE-NLEDLDGVGPATAEKLQDAGVADPEDLHEVDPDAVAGEVQGVSADRIREWQDE
11645|gene|hma      ARTAIE-DLEDLNGIGSATAEKLGDAGVDSLAALREADPDIVATEVQGVSATQVRDWQDE
2187|gene|hhi       ARTAVE-DLEDLNGIGSATAEKLGDAGVDSLAALREADPDIVATEVQGVSATQVREWQDE
1267|gene|hwa       SDQTDSSTLESVHGIGAKTAEKLKDAGVDTVSALKSAEANTLADRVDGVSVDRLRKWQST
25370|gene|hbo      AEQAGGDELQSVKGIGEKTAEKLKAAGIEDVPSLKEAEPDALADLVDGVGPDTVRKWQSA
259|gene|hla        ARQEGS-ELQTVEGIGEKTAEKLKDAGVDGVDDLKSIDPDELAADVDGVGADTVRDWQAK
                                                                                

293|hp|hhi          --------
349|gene|nrc1       AD------
1222|gene|nph       ANVSASAD
2731|gene|hut       LAA-----
11645|gene|hma      LEA-----
2187|gene|hhi       LEA-----
1267|gene|hwa       AD------
25370|gene|hbo      AD------
259|gene|hla        AD------